Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B873

Protein Details
Accession A0A0P7B873    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
201-248ADAAKPPKAKKIKAKKELEAGKNKWQEFSKSKPGKTKKKDSMFRTPTGHydrophilic
NLS Segment(s)
PositionSequence
204-239AKPPKAKKIKAKKELEAGKNKWQEFSKSKPGKTKKK
Subcellular Location(s) nucl 11.5, cyto_nucl 11.5, cyto 10.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSALADLEAERQQYQEQFDIVLGQLRDDPENAELKALQDELKEFINLLNENIAELKPKQAPKPAPKETSPPPQPEKWSRENHPAFKKAAPVEDKEDAPVVYQVNDTILAKWVSGDKAFYQGRITSITGSSTDPIYTVRFKSYDTTETLRSRDIRPVSNKRKADGPPVASGTSTPTPPAPGVVTSAGATVYPGARKEAEPDADAAKPPKAKKIKAKKELEAGKNKWQEFSKSKPGKTKKKDSMFRTPTGVHGRVGFTGSGQAMRKDPTRSRHVYQVNEELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.19
5 0.19
6 0.2
7 0.17
8 0.19
9 0.15
10 0.14
11 0.16
12 0.16
13 0.18
14 0.16
15 0.18
16 0.16
17 0.19
18 0.19
19 0.18
20 0.17
21 0.17
22 0.18
23 0.17
24 0.15
25 0.13
26 0.14
27 0.14
28 0.15
29 0.14
30 0.12
31 0.13
32 0.16
33 0.15
34 0.15
35 0.15
36 0.13
37 0.14
38 0.15
39 0.14
40 0.12
41 0.12
42 0.17
43 0.21
44 0.25
45 0.29
46 0.36
47 0.45
48 0.52
49 0.62
50 0.65
51 0.65
52 0.63
53 0.66
54 0.64
55 0.66
56 0.62
57 0.6
58 0.57
59 0.56
60 0.61
61 0.63
62 0.63
63 0.61
64 0.62
65 0.6
66 0.65
67 0.68
68 0.69
69 0.68
70 0.65
71 0.59
72 0.53
73 0.54
74 0.45
75 0.44
76 0.39
77 0.34
78 0.35
79 0.35
80 0.33
81 0.28
82 0.27
83 0.21
84 0.18
85 0.17
86 0.12
87 0.09
88 0.09
89 0.08
90 0.08
91 0.09
92 0.09
93 0.07
94 0.09
95 0.09
96 0.09
97 0.09
98 0.1
99 0.1
100 0.1
101 0.11
102 0.08
103 0.15
104 0.16
105 0.16
106 0.16
107 0.16
108 0.16
109 0.18
110 0.18
111 0.11
112 0.12
113 0.12
114 0.11
115 0.11
116 0.11
117 0.09
118 0.08
119 0.07
120 0.08
121 0.09
122 0.1
123 0.1
124 0.11
125 0.12
126 0.12
127 0.15
128 0.16
129 0.17
130 0.18
131 0.2
132 0.23
133 0.25
134 0.25
135 0.25
136 0.25
137 0.24
138 0.27
139 0.27
140 0.28
141 0.35
142 0.45
143 0.52
144 0.59
145 0.58
146 0.53
147 0.57
148 0.53
149 0.53
150 0.48
151 0.42
152 0.36
153 0.37
154 0.36
155 0.29
156 0.27
157 0.23
158 0.19
159 0.16
160 0.13
161 0.11
162 0.12
163 0.12
164 0.13
165 0.09
166 0.08
167 0.1
168 0.1
169 0.11
170 0.1
171 0.1
172 0.09
173 0.08
174 0.07
175 0.06
176 0.07
177 0.07
178 0.08
179 0.09
180 0.11
181 0.11
182 0.15
183 0.19
184 0.2
185 0.19
186 0.2
187 0.21
188 0.2
189 0.22
190 0.2
191 0.19
192 0.22
193 0.23
194 0.31
195 0.36
196 0.42
197 0.52
198 0.61
199 0.69
200 0.74
201 0.8
202 0.76
203 0.78
204 0.81
205 0.79
206 0.78
207 0.71
208 0.71
209 0.7
210 0.65
211 0.6
212 0.54
213 0.53
214 0.49
215 0.52
216 0.53
217 0.54
218 0.59
219 0.65
220 0.72
221 0.76
222 0.8
223 0.83
224 0.82
225 0.84
226 0.88
227 0.86
228 0.87
229 0.82
230 0.76
231 0.7
232 0.61
233 0.58
234 0.57
235 0.51
236 0.41
237 0.37
238 0.35
239 0.31
240 0.31
241 0.24
242 0.16
243 0.17
244 0.17
245 0.19
246 0.19
247 0.2
248 0.21
249 0.25
250 0.29
251 0.33
252 0.4
253 0.43
254 0.51
255 0.56
256 0.57
257 0.64
258 0.67
259 0.66
260 0.66