Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B6X2

Protein Details
Accession A0A0P7B6X2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-51QHSTSPSPQPKPKPKPKPKPKLAQQETDHydrophilic
NLS Segment(s)
PositionSequence
33-44PKPKPKPKPKPK
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito_nucl 9.833, cyto 5.5, mito 3.5
Family & Domain DBs
Amino Acid Sequences MLVKALGPGFDLSKTLDSQPGTHQHSTSPSPQPKPKPKPKPKPKLAQQETDPRDPSPNPMPTQKSVPYQRARVVAVSHTELEEAIHLVIQGWSSDLPTGPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.18
5 0.2
6 0.24
7 0.3
8 0.34
9 0.34
10 0.33
11 0.31
12 0.34
13 0.36
14 0.37
15 0.38
16 0.39
17 0.44
18 0.51
19 0.59
20 0.66
21 0.73
22 0.78
23 0.8
24 0.84
25 0.89
26 0.92
27 0.93
28 0.92
29 0.92
30 0.9
31 0.9
32 0.84
33 0.78
34 0.72
35 0.71
36 0.65
37 0.59
38 0.5
39 0.39
40 0.38
41 0.32
42 0.32
43 0.28
44 0.29
45 0.27
46 0.32
47 0.35
48 0.34
49 0.39
50 0.38
51 0.39
52 0.4
53 0.46
54 0.46
55 0.46
56 0.48
57 0.46
58 0.44
59 0.38
60 0.34
61 0.28
62 0.26
63 0.25
64 0.21
65 0.18
66 0.17
67 0.15
68 0.13
69 0.12
70 0.09
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.08
81 0.09