Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7B5W5

Protein Details
Accession A0A0P7B5W5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-94RDKPSRKSFNRRGVKERQEKSBasic
NLS Segment(s)
Subcellular Location(s) mito 13extr 13
Family & Domain DBs
Amino Acid Sequences MKTTSALAFLLATMAPFTASLPTSHNAVAGGPLHVRTPKLTPLFVNGTTPEDTVPVPGKPIFVPADGTILLVGRDKPSRKSFNRRGVKERQEKSSTNIAPLSRRGGGSAAPVGNETDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.07
6 0.08
7 0.09
8 0.12
9 0.13
10 0.15
11 0.15
12 0.15
13 0.13
14 0.12
15 0.13
16 0.11
17 0.11
18 0.09
19 0.1
20 0.11
21 0.12
22 0.13
23 0.12
24 0.14
25 0.2
26 0.22
27 0.22
28 0.21
29 0.25
30 0.28
31 0.27
32 0.26
33 0.2
34 0.2
35 0.2
36 0.19
37 0.14
38 0.11
39 0.11
40 0.11
41 0.12
42 0.09
43 0.1
44 0.1
45 0.1
46 0.09
47 0.12
48 0.12
49 0.1
50 0.12
51 0.11
52 0.12
53 0.11
54 0.11
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.12
62 0.14
63 0.2
64 0.28
65 0.37
66 0.44
67 0.54
68 0.62
69 0.68
70 0.77
71 0.77
72 0.77
73 0.78
74 0.81
75 0.8
76 0.75
77 0.73
78 0.69
79 0.64
80 0.62
81 0.62
82 0.52
83 0.46
84 0.45
85 0.39
86 0.36
87 0.37
88 0.37
89 0.29
90 0.28
91 0.26
92 0.23
93 0.22
94 0.22
95 0.25
96 0.21
97 0.19
98 0.19