Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7B3Q8

Protein Details
Accession A0A0P7B3Q8   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-53QRQMQKKQQKQAQKKRQQKQGHDLTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MHTTRPHTPPPHQAATPPWQAGLHLREQRQMQKKQQKQAQKKRQQKQGHDLTPLRPPLPLCLIRTQIANAERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.5
4 0.4
5 0.33
6 0.27
7 0.27
8 0.29
9 0.26
10 0.28
11 0.27
12 0.28
13 0.31
14 0.34
15 0.42
16 0.46
17 0.5
18 0.52
19 0.58
20 0.63
21 0.67
22 0.71
23 0.72
24 0.74
25 0.79
26 0.8
27 0.8
28 0.84
29 0.84
30 0.88
31 0.87
32 0.83
33 0.82
34 0.81
35 0.75
36 0.73
37 0.67
38 0.59
39 0.57
40 0.52
41 0.42
42 0.34
43 0.3
44 0.26
45 0.32
46 0.33
47 0.3
48 0.33
49 0.37
50 0.36
51 0.37
52 0.34
53 0.33