Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B2K8

Protein Details
Accession A0A0P7B2K8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-90LGSCPKKECPSKKMAKKTTKKTKKTKKTTTHydrophilic
NLS Segment(s)
PositionSequence
71-87SKKMAKKTTKKTKKTKK
Subcellular Location(s) mito 16.5, cyto_mito 10.833, nucl 5.5, cyto_nucl 5.333, cyto 4
Family & Domain DBs
Amino Acid Sequences MCSLVWDKCPVCEHLRYAKTYKCARWRVAAALAEARGCTLPSWEVCVDLSEEKKIAGLIPLGSCPKKECPSKKMAKKTTKKTKKTKKTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.46
4 0.47
5 0.48
6 0.51
7 0.53
8 0.56
9 0.55
10 0.58
11 0.57
12 0.58
13 0.56
14 0.52
15 0.5
16 0.44
17 0.36
18 0.31
19 0.28
20 0.22
21 0.19
22 0.16
23 0.1
24 0.09
25 0.07
26 0.06
27 0.07
28 0.07
29 0.1
30 0.1
31 0.1
32 0.1
33 0.1
34 0.11
35 0.11
36 0.12
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.14
50 0.15
51 0.17
52 0.22
53 0.28
54 0.37
55 0.43
56 0.46
57 0.56
58 0.66
59 0.73
60 0.77
61 0.81
62 0.82
63 0.85
64 0.9
65 0.91
66 0.91
67 0.92
68 0.92
69 0.93
70 0.93