Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6G7J8

Protein Details
Accession A0A0K6G7J8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-107SDDGAAPRKRRARRTKAEMEADAHydrophilic
NLS Segment(s)
PositionSequence
91-100PRKRRARRTK
Subcellular Location(s) cyto 14, cyto_nucl 10.5, nucl 5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MQKDDEVGKVAQATPIVISKALELFMADLVQEGSSITIQRGAKRLEAYHLKHAIETIDTFDFLREIVAPVPDPTNGGQIPEDGGSDDGAAPRKRRARRTKAEMEADAERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.12
5 0.12
6 0.11
7 0.11
8 0.11
9 0.1
10 0.08
11 0.07
12 0.07
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.04
20 0.04
21 0.05
22 0.06
23 0.05
24 0.11
25 0.12
26 0.14
27 0.19
28 0.19
29 0.22
30 0.23
31 0.24
32 0.24
33 0.3
34 0.31
35 0.34
36 0.36
37 0.34
38 0.32
39 0.32
40 0.26
41 0.19
42 0.16
43 0.11
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.07
51 0.04
52 0.05
53 0.06
54 0.06
55 0.07
56 0.08
57 0.09
58 0.08
59 0.09
60 0.09
61 0.13
62 0.12
63 0.13
64 0.12
65 0.11
66 0.13
67 0.12
68 0.11
69 0.08
70 0.08
71 0.07
72 0.07
73 0.08
74 0.09
75 0.15
76 0.18
77 0.19
78 0.27
79 0.35
80 0.43
81 0.53
82 0.63
83 0.67
84 0.75
85 0.83
86 0.85
87 0.86
88 0.86
89 0.77
90 0.71