Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FK63

Protein Details
Accession Q6FK63    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAVGKNKRLSKGKKGLKKKVVDPFTRKEBasic
NLS Segment(s)
PositionSequence
5-19KNKRLSKGKKGLKKK
Subcellular Location(s) nucl 11, mito 7, pero 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027500  Ribosomal_S1/3_euk  
IPR001593  Ribosomal_S3Ae  
IPR018281  Ribosomal_S3Ae_CS  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0062040  C:fungal biofilm matrix  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cgr:CAGL0M00814g  -  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
PROSITE View protein in PROSITE  
PS01191  RIBOSOMAL_S3AE  
Amino Acid Sequences MAVGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDDVQGKNLLTNFHGMDFTADKLRSMVRKWQTLIEANVTVKTSDEYIIRVFAIAFTRKQSNQVKRTAYAQSSHIRAIRKVISDILTREVSNSTLAQFTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLLKQPKFDLGSLMALHGEGSAEEKGKKVSGFKDEVLETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.87
5 0.85
6 0.84
7 0.84
8 0.83
9 0.8
10 0.76
11 0.74
12 0.72
13 0.65
14 0.6
15 0.55
16 0.48
17 0.49
18 0.45
19 0.41
20 0.39
21 0.4
22 0.39
23 0.41
24 0.41
25 0.36
26 0.42
27 0.39
28 0.38
29 0.39
30 0.36
31 0.32
32 0.35
33 0.38
34 0.33
35 0.34
36 0.32
37 0.33
38 0.36
39 0.36
40 0.32
41 0.26
42 0.22
43 0.27
44 0.27
45 0.28
46 0.25
47 0.24
48 0.26
49 0.25
50 0.25
51 0.2
52 0.19
53 0.17
54 0.16
55 0.15
56 0.11
57 0.11
58 0.1
59 0.08
60 0.08
61 0.07
62 0.09
63 0.09
64 0.09
65 0.1
66 0.13
67 0.14
68 0.14
69 0.23
70 0.25
71 0.3
72 0.35
73 0.4
74 0.41
75 0.46
76 0.55
77 0.48
78 0.48
79 0.44
80 0.38
81 0.33
82 0.3
83 0.24
84 0.15
85 0.15
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.11
93 0.12
94 0.12
95 0.11
96 0.12
97 0.14
98 0.15
99 0.16
100 0.23
101 0.24
102 0.28
103 0.29
104 0.31
105 0.31
106 0.32
107 0.31
108 0.25
109 0.22
110 0.18
111 0.18
112 0.16
113 0.13
114 0.1
115 0.09
116 0.08
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.08
124 0.07
125 0.07
126 0.09
127 0.1
128 0.1
129 0.12
130 0.15
131 0.15
132 0.24
133 0.31
134 0.38
135 0.42
136 0.49
137 0.5
138 0.48
139 0.51
140 0.48
141 0.41
142 0.33
143 0.32
144 0.29
145 0.28
146 0.29
147 0.29
148 0.26
149 0.25
150 0.27
151 0.27
152 0.24
153 0.23
154 0.23
155 0.23
156 0.23
157 0.24
158 0.23
159 0.21
160 0.19
161 0.19
162 0.17
163 0.15
164 0.14
165 0.14
166 0.1
167 0.1
168 0.1
169 0.11
170 0.1
171 0.11
172 0.13
173 0.13
174 0.13
175 0.13
176 0.15
177 0.17
178 0.21
179 0.22
180 0.21
181 0.2
182 0.22
183 0.23
184 0.23
185 0.22
186 0.19
187 0.18
188 0.16
189 0.16
190 0.18
191 0.17
192 0.16
193 0.17
194 0.19
195 0.25
196 0.26
197 0.31
198 0.33
199 0.32
200 0.37
201 0.41
202 0.46
203 0.49
204 0.58
205 0.61
206 0.64
207 0.69
208 0.71
209 0.68
210 0.6
211 0.53
212 0.44
213 0.4
214 0.32
215 0.27
216 0.2
217 0.15
218 0.14
219 0.11
220 0.09
221 0.05
222 0.08
223 0.09
224 0.11
225 0.12
226 0.13
227 0.15
228 0.18
229 0.2
230 0.23
231 0.28
232 0.33
233 0.38
234 0.38
235 0.42