Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6G7M3

Protein Details
Accession A0A0K6G7M3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
162-186VTWAIAEKKARDRRRSRRNGGGGGGHydrophilic
NLS Segment(s)
PositionSequence
169-186KKARDRRRSRRNGGGGGG
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MTTYTLSRTSPKNTVLTDPEGKEVYEISSKYHLGGSETTVKRGDQVLATIHWKLFLRSTITWDGQTTKINEIFPRSRRLSLSRIYTTPSGEKFKWKDKARLYVRNSGLSRAVSQLRLYLCVSVDTGLNLATYERVHFRYFRDKKSTLDITSAGAHLADALVVTWAIAEKKARDRRRSRRNGGGGGGGGGDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.47
4 0.48
5 0.43
6 0.42
7 0.37
8 0.35
9 0.29
10 0.25
11 0.21
12 0.19
13 0.18
14 0.18
15 0.21
16 0.21
17 0.21
18 0.23
19 0.2
20 0.18
21 0.18
22 0.19
23 0.25
24 0.26
25 0.27
26 0.27
27 0.26
28 0.25
29 0.26
30 0.23
31 0.14
32 0.15
33 0.15
34 0.16
35 0.18
36 0.18
37 0.16
38 0.17
39 0.16
40 0.15
41 0.16
42 0.16
43 0.19
44 0.19
45 0.24
46 0.26
47 0.27
48 0.27
49 0.26
50 0.26
51 0.22
52 0.25
53 0.22
54 0.2
55 0.21
56 0.22
57 0.22
58 0.25
59 0.3
60 0.29
61 0.35
62 0.34
63 0.34
64 0.35
65 0.38
66 0.37
67 0.36
68 0.4
69 0.35
70 0.33
71 0.33
72 0.32
73 0.29
74 0.28
75 0.26
76 0.23
77 0.21
78 0.28
79 0.29
80 0.35
81 0.43
82 0.44
83 0.48
84 0.49
85 0.58
86 0.59
87 0.65
88 0.61
89 0.61
90 0.59
91 0.58
92 0.54
93 0.45
94 0.4
95 0.31
96 0.27
97 0.21
98 0.21
99 0.15
100 0.14
101 0.16
102 0.14
103 0.16
104 0.15
105 0.13
106 0.12
107 0.12
108 0.12
109 0.09
110 0.09
111 0.07
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.07
120 0.1
121 0.12
122 0.14
123 0.15
124 0.2
125 0.3
126 0.36
127 0.42
128 0.48
129 0.48
130 0.48
131 0.55
132 0.57
133 0.47
134 0.44
135 0.37
136 0.31
137 0.3
138 0.28
139 0.19
140 0.13
141 0.11
142 0.08
143 0.07
144 0.05
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.05
152 0.05
153 0.08
154 0.1
155 0.15
156 0.25
157 0.36
158 0.45
159 0.54
160 0.65
161 0.74
162 0.83
163 0.9
164 0.88
165 0.89
166 0.89
167 0.84
168 0.76
169 0.7
170 0.59
171 0.48
172 0.4