Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FV57

Protein Details
Accession Q6FV57   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
327-347SYKRVLKRYSRDKSNKKYALKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036420  BRCT_dom_sf  
IPR013939  Regulatory_Dfp1/Him1  
IPR006572  Znf_DBF  
IPR038545  Znf_DBF_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0000775  C:chromosome, centromeric region  
GO:0031431  C:Dbf4-dependent protein kinase complex  
GO:0003688  F:DNA replication origin binding  
GO:0043539  F:protein serine/threonine kinase activator activity  
GO:0008270  F:zinc ion binding  
GO:0006270  P:DNA replication initiation  
GO:0033314  P:mitotic DNA replication checkpoint signaling  
GO:0001100  P:negative regulation of exit from mitosis  
GO:1903468  P:positive regulation of DNA replication initiation  
GO:1905561  P:positive regulation of kinetochore assembly  
GO:0060903  P:positive regulation of meiosis I  
GO:1903343  P:positive regulation of meiotic DNA double-strand break formation  
GO:0001934  P:positive regulation of protein phosphorylation  
GO:0006279  P:premeiotic DNA replication  
GO:0006468  P:protein phosphorylation  
KEGG cgr:CAGL0E04576g  -  
Pfam View protein in Pfam  
PF08630  Dfp1_Him1_M  
PF07535  zf-DBF  
PROSITE View protein in PROSITE  
PS51265  ZF_DBF4  
Amino Acid Sequences MASNENLISHAGGVYAARSPLKETDANSKPAGTLTINNEDRDLKKRLIETTNEKLQLRKRAKLERGRSIEGAVQVTKGVALRNVESQGRSISGQGTVSGTASNQSGNNNNKVALGELLEWQMNWRNIMRRDSRIYFDTTDEPDITKHAKSKLEKRKLLLKCGFMSLGAQITQFFDTSVTIVISSRSIDNITQLNETDILARAKKSYMKVWGYDKAARFLKNLDVDLENLEKNKLPTIASPSLSNLLQNEKLFGPSDRDPRTRRDDIHYFKYPHIYMYDLWQTWAPIITLEWKPQELANPNNLPYPTLKMGTFGRCPFIGDRSCDESSYKRVLKRYSRDKSNKKYALKLRGLYQHHADPTVSMTKNLIFIPHLCLDSAQCYEKWQEQHMKEQYRIKHKDGELPIQKDSKDGTNEDKESEIRQNEKEISIGKIDNDNGESKIEEIAENSKLVQRDSVWKGIVPTVKLEQSKRSLPQLNRQETEEFPDDLCTVKKYSRDQYEIKASGVHQSNDIATSFGNGLGPTRASVMSKNMKSLSRFVVDKKIATQTTSGNNVSSSTNLKHMSAANGNAAKVSNESIMEVQHKVNDDTSKEVQKTTINPENNLINAAPGNNNSSNLTSHLVQNNQVTSKRPLMKNSGYCENCRVKYEYLDLHVVSEKHLSFANNDINFEAIDSLIEKLGFQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.12
5 0.13
6 0.16
7 0.19
8 0.24
9 0.26
10 0.27
11 0.35
12 0.4
13 0.44
14 0.41
15 0.39
16 0.34
17 0.32
18 0.32
19 0.24
20 0.24
21 0.25
22 0.34
23 0.36
24 0.36
25 0.38
26 0.39
27 0.4
28 0.41
29 0.4
30 0.33
31 0.35
32 0.39
33 0.44
34 0.45
35 0.5
36 0.52
37 0.55
38 0.61
39 0.61
40 0.58
41 0.57
42 0.58
43 0.61
44 0.59
45 0.59
46 0.59
47 0.64
48 0.73
49 0.78
50 0.8
51 0.8
52 0.8
53 0.77
54 0.7
55 0.62
56 0.55
57 0.48
58 0.42
59 0.32
60 0.25
61 0.2
62 0.18
63 0.17
64 0.14
65 0.12
66 0.12
67 0.14
68 0.15
69 0.19
70 0.23
71 0.24
72 0.24
73 0.24
74 0.23
75 0.22
76 0.21
77 0.19
78 0.17
79 0.16
80 0.15
81 0.15
82 0.14
83 0.13
84 0.13
85 0.12
86 0.1
87 0.1
88 0.1
89 0.11
90 0.11
91 0.13
92 0.21
93 0.26
94 0.31
95 0.31
96 0.31
97 0.3
98 0.29
99 0.27
100 0.2
101 0.16
102 0.12
103 0.13
104 0.14
105 0.13
106 0.12
107 0.13
108 0.19
109 0.18
110 0.19
111 0.21
112 0.28
113 0.33
114 0.41
115 0.45
116 0.45
117 0.52
118 0.53
119 0.54
120 0.49
121 0.49
122 0.42
123 0.39
124 0.37
125 0.32
126 0.32
127 0.28
128 0.25
129 0.21
130 0.23
131 0.22
132 0.2
133 0.22
134 0.24
135 0.31
136 0.38
137 0.48
138 0.56
139 0.64
140 0.67
141 0.67
142 0.72
143 0.69
144 0.72
145 0.67
146 0.62
147 0.53
148 0.5
149 0.46
150 0.36
151 0.32
152 0.23
153 0.18
154 0.13
155 0.12
156 0.09
157 0.11
158 0.11
159 0.1
160 0.09
161 0.08
162 0.08
163 0.08
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.09
174 0.09
175 0.12
176 0.14
177 0.15
178 0.15
179 0.15
180 0.15
181 0.14
182 0.14
183 0.13
184 0.13
185 0.13
186 0.13
187 0.14
188 0.14
189 0.16
190 0.2
191 0.21
192 0.23
193 0.3
194 0.32
195 0.36
196 0.4
197 0.43
198 0.43
199 0.46
200 0.42
201 0.4
202 0.41
203 0.38
204 0.34
205 0.3
206 0.31
207 0.29
208 0.28
209 0.23
210 0.2
211 0.2
212 0.21
213 0.21
214 0.16
215 0.14
216 0.14
217 0.13
218 0.13
219 0.14
220 0.13
221 0.12
222 0.14
223 0.21
224 0.24
225 0.24
226 0.24
227 0.23
228 0.24
229 0.23
230 0.22
231 0.15
232 0.15
233 0.17
234 0.16
235 0.17
236 0.15
237 0.16
238 0.16
239 0.16
240 0.18
241 0.19
242 0.28
243 0.31
244 0.37
245 0.38
246 0.43
247 0.51
248 0.5
249 0.48
250 0.48
251 0.52
252 0.52
253 0.57
254 0.58
255 0.53
256 0.49
257 0.51
258 0.44
259 0.36
260 0.3
261 0.25
262 0.17
263 0.19
264 0.23
265 0.18
266 0.18
267 0.17
268 0.16
269 0.15
270 0.15
271 0.1
272 0.06
273 0.06
274 0.1
275 0.11
276 0.14
277 0.14
278 0.14
279 0.14
280 0.15
281 0.19
282 0.19
283 0.2
284 0.24
285 0.25
286 0.26
287 0.28
288 0.27
289 0.24
290 0.2
291 0.22
292 0.17
293 0.16
294 0.16
295 0.15
296 0.18
297 0.21
298 0.24
299 0.2
300 0.2
301 0.19
302 0.2
303 0.19
304 0.21
305 0.2
306 0.19
307 0.21
308 0.25
309 0.26
310 0.25
311 0.25
312 0.22
313 0.24
314 0.28
315 0.29
316 0.26
317 0.3
318 0.36
319 0.43
320 0.5
321 0.56
322 0.57
323 0.64
324 0.71
325 0.77
326 0.79
327 0.82
328 0.81
329 0.72
330 0.73
331 0.7
332 0.7
333 0.65
334 0.58
335 0.52
336 0.52
337 0.52
338 0.45
339 0.41
340 0.34
341 0.3
342 0.29
343 0.24
344 0.16
345 0.16
346 0.2
347 0.17
348 0.14
349 0.14
350 0.14
351 0.16
352 0.16
353 0.14
354 0.08
355 0.09
356 0.13
357 0.14
358 0.14
359 0.12
360 0.12
361 0.12
362 0.14
363 0.14
364 0.11
365 0.1
366 0.11
367 0.13
368 0.17
369 0.18
370 0.21
371 0.27
372 0.28
373 0.37
374 0.43
375 0.45
376 0.45
377 0.5
378 0.51
379 0.53
380 0.56
381 0.5
382 0.5
383 0.48
384 0.52
385 0.49
386 0.53
387 0.49
388 0.47
389 0.47
390 0.42
391 0.41
392 0.34
393 0.31
394 0.26
395 0.21
396 0.21
397 0.24
398 0.27
399 0.28
400 0.28
401 0.28
402 0.24
403 0.25
404 0.28
405 0.25
406 0.22
407 0.22
408 0.25
409 0.25
410 0.25
411 0.23
412 0.19
413 0.18
414 0.17
415 0.17
416 0.15
417 0.16
418 0.16
419 0.15
420 0.15
421 0.15
422 0.13
423 0.14
424 0.13
425 0.1
426 0.11
427 0.1
428 0.09
429 0.08
430 0.11
431 0.11
432 0.11
433 0.11
434 0.13
435 0.13
436 0.13
437 0.14
438 0.12
439 0.2
440 0.23
441 0.27
442 0.24
443 0.24
444 0.25
445 0.28
446 0.29
447 0.21
448 0.2
449 0.19
450 0.23
451 0.26
452 0.27
453 0.28
454 0.3
455 0.35
456 0.35
457 0.39
458 0.43
459 0.43
460 0.51
461 0.56
462 0.58
463 0.55
464 0.55
465 0.5
466 0.43
467 0.46
468 0.39
469 0.3
470 0.23
471 0.23
472 0.2
473 0.18
474 0.19
475 0.14
476 0.13
477 0.15
478 0.2
479 0.24
480 0.32
481 0.39
482 0.44
483 0.46
484 0.5
485 0.57
486 0.53
487 0.48
488 0.41
489 0.34
490 0.35
491 0.36
492 0.3
493 0.22
494 0.21
495 0.21
496 0.2
497 0.2
498 0.13
499 0.09
500 0.1
501 0.09
502 0.08
503 0.09
504 0.07
505 0.08
506 0.09
507 0.09
508 0.08
509 0.1
510 0.1
511 0.11
512 0.12
513 0.19
514 0.27
515 0.28
516 0.31
517 0.33
518 0.36
519 0.38
520 0.4
521 0.37
522 0.33
523 0.34
524 0.33
525 0.4
526 0.38
527 0.37
528 0.36
529 0.39
530 0.35
531 0.34
532 0.33
533 0.28
534 0.31
535 0.35
536 0.32
537 0.25
538 0.25
539 0.25
540 0.23
541 0.21
542 0.2
543 0.16
544 0.21
545 0.22
546 0.22
547 0.23
548 0.24
549 0.27
550 0.27
551 0.27
552 0.27
553 0.28
554 0.27
555 0.26
556 0.24
557 0.2
558 0.17
559 0.17
560 0.13
561 0.11
562 0.13
563 0.12
564 0.14
565 0.17
566 0.17
567 0.17
568 0.18
569 0.2
570 0.2
571 0.23
572 0.25
573 0.24
574 0.29
575 0.33
576 0.38
577 0.37
578 0.36
579 0.35
580 0.35
581 0.38
582 0.4
583 0.44
584 0.39
585 0.4
586 0.43
587 0.43
588 0.39
589 0.36
590 0.27
591 0.2
592 0.18
593 0.18
594 0.16
595 0.15
596 0.2
597 0.19
598 0.21
599 0.21
600 0.22
601 0.22
602 0.22
603 0.25
604 0.2
605 0.25
606 0.29
607 0.3
608 0.32
609 0.34
610 0.36
611 0.37
612 0.38
613 0.36
614 0.36
615 0.43
616 0.49
617 0.49
618 0.5
619 0.55
620 0.62
621 0.65
622 0.66
623 0.67
624 0.61
625 0.6
626 0.63
627 0.62
628 0.56
629 0.53
630 0.51
631 0.44
632 0.45
633 0.48
634 0.45
635 0.4
636 0.42
637 0.38
638 0.36
639 0.37
640 0.33
641 0.28
642 0.29
643 0.24
644 0.21
645 0.24
646 0.22
647 0.2
648 0.26
649 0.34
650 0.29
651 0.3
652 0.29
653 0.28
654 0.26
655 0.25
656 0.19
657 0.1
658 0.09
659 0.08
660 0.09
661 0.1
662 0.1