Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B4UMX1

Protein Details
Accession B4UMX1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
196-221ATTPGTQAKKPRKPRQTKKQQQAAAAHydrophilic
NLS Segment(s)
PositionSequence
204-213KKPRKPRQTK
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020998  Med3  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG cgr:CAGL0A01325g  -  
Pfam View protein in Pfam  
PF11593  Med3  
Amino Acid Sequences MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIKKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQLNQMFPMQNHNQNGHFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNMGMNMNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQNQNQNQSMNMNMNNDSNNPKSAYDLVDFNSLDLSSLNMDFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.16
4 0.13
5 0.13
6 0.13
7 0.09
8 0.11
9 0.18
10 0.18
11 0.19
12 0.19
13 0.2
14 0.2
15 0.2
16 0.21
17 0.13
18 0.16
19 0.2
20 0.21
21 0.21
22 0.21
23 0.21
24 0.25
25 0.31
26 0.35
27 0.38
28 0.45
29 0.48
30 0.56
31 0.56
32 0.51
33 0.46
34 0.45
35 0.37
36 0.36
37 0.36
38 0.32
39 0.31
40 0.31
41 0.32
42 0.27
43 0.27
44 0.21
45 0.2
46 0.22
47 0.22
48 0.21
49 0.19
50 0.2
51 0.18
52 0.18
53 0.17
54 0.13
55 0.13
56 0.14
57 0.13
58 0.13
59 0.16
60 0.18
61 0.18
62 0.22
63 0.28
64 0.29
65 0.34
66 0.38
67 0.4
68 0.4
69 0.46
70 0.5
71 0.47
72 0.5
73 0.46
74 0.44
75 0.39
76 0.41
77 0.36
78 0.29
79 0.29
80 0.27
81 0.27
82 0.25
83 0.24
84 0.21
85 0.19
86 0.19
87 0.16
88 0.15
89 0.14
90 0.13
91 0.14
92 0.14
93 0.13
94 0.09
95 0.09
96 0.08
97 0.07
98 0.08
99 0.07
100 0.08
101 0.08
102 0.09
103 0.12
104 0.18
105 0.22
106 0.27
107 0.34
108 0.41
109 0.47
110 0.56
111 0.56
112 0.53
113 0.57
114 0.53
115 0.49
116 0.42
117 0.35
118 0.26
119 0.24
120 0.24
121 0.2
122 0.19
123 0.18
124 0.16
125 0.16
126 0.22
127 0.24
128 0.26
129 0.23
130 0.23
131 0.24
132 0.26
133 0.25
134 0.19
135 0.16
136 0.12
137 0.13
138 0.11
139 0.13
140 0.11
141 0.13
142 0.13
143 0.16
144 0.16
145 0.14
146 0.14
147 0.11
148 0.14
149 0.16
150 0.18
151 0.16
152 0.18
153 0.24
154 0.26
155 0.29
156 0.28
157 0.26
158 0.28
159 0.34
160 0.38
161 0.34
162 0.32
163 0.29
164 0.31
165 0.28
166 0.25
167 0.18
168 0.13
169 0.12
170 0.12
171 0.12
172 0.1
173 0.12
174 0.12
175 0.13
176 0.11
177 0.11
178 0.14
179 0.14
180 0.14
181 0.12
182 0.13
183 0.13
184 0.14
185 0.14
186 0.16
187 0.18
188 0.2
189 0.28
190 0.37
191 0.45
192 0.55
193 0.64
194 0.7
195 0.78
196 0.86
197 0.89
198 0.91
199 0.92
200 0.91
201 0.9
202 0.83
203 0.75
204 0.68
205 0.58
206 0.47
207 0.36
208 0.26
209 0.17
210 0.12
211 0.09
212 0.05
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.05
220 0.08
221 0.09
222 0.15
223 0.16
224 0.22
225 0.23
226 0.24
227 0.26
228 0.28
229 0.32
230 0.28
231 0.29
232 0.27
233 0.27
234 0.27
235 0.28
236 0.24
237 0.2
238 0.19
239 0.21
240 0.18
241 0.18
242 0.16
243 0.13
244 0.13
245 0.12
246 0.11
247 0.08
248 0.07
249 0.1
250 0.11
251 0.11
252 0.11
253 0.18
254 0.19
255 0.19
256 0.17
257 0.18
258 0.22
259 0.25
260 0.25
261 0.19
262 0.2
263 0.21
264 0.21
265 0.22
266 0.18
267 0.15
268 0.15
269 0.15
270 0.14
271 0.13
272 0.14
273 0.12
274 0.12
275 0.11
276 0.1
277 0.11
278 0.12
279 0.13
280 0.14
281 0.16
282 0.14
283 0.18
284 0.19
285 0.2
286 0.2
287 0.19
288 0.18
289 0.15
290 0.15
291 0.12
292 0.11
293 0.09
294 0.08
295 0.1
296 0.11
297 0.12
298 0.11
299 0.11
300 0.12
301 0.14
302 0.15
303 0.13
304 0.12
305 0.18
306 0.23
307 0.24
308 0.23
309 0.22
310 0.29
311 0.32
312 0.33
313 0.26
314 0.22
315 0.23
316 0.22
317 0.22
318 0.13
319 0.1
320 0.1
321 0.1
322 0.1
323 0.08
324 0.08
325 0.09
326 0.15
327 0.16
328 0.15
329 0.14
330 0.15
331 0.16
332 0.16
333 0.22
334 0.21
335 0.25
336 0.28
337 0.3
338 0.31
339 0.32
340 0.33
341 0.28
342 0.24
343 0.19
344 0.19
345 0.19
346 0.2
347 0.19
348 0.19
349 0.18
350 0.17
351 0.16
352 0.15
353 0.14
354 0.14
355 0.14
356 0.2
357 0.21
358 0.22
359 0.24
360 0.24
361 0.26
362 0.24
363 0.26
364 0.2
365 0.21
366 0.2
367 0.17
368 0.16
369 0.13
370 0.15
371 0.11
372 0.12
373 0.09
374 0.09
375 0.09
376 0.1
377 0.09
378 0.08
379 0.08
380 0.09
381 0.09
382 0.09
383 0.1
384 0.09
385 0.1
386 0.1
387 0.1
388 0.11
389 0.11
390 0.1
391 0.11
392 0.11
393 0.1
394 0.1
395 0.1
396 0.1
397 0.1
398 0.11
399 0.12
400 0.17
401 0.2
402 0.2
403 0.22
404 0.21
405 0.25
406 0.32
407 0.33
408 0.34
409 0.35
410 0.37
411 0.35
412 0.36
413 0.34
414 0.28
415 0.28
416 0.23
417 0.28
418 0.3
419 0.35
420 0.34
421 0.4
422 0.44
423 0.51
424 0.55
425 0.53
426 0.53
427 0.5
428 0.5
429 0.45
430 0.43
431 0.39
432 0.36
433 0.32
434 0.29
435 0.3
436 0.29
437 0.3
438 0.32
439 0.29
440 0.3
441 0.29
442 0.27
443 0.28
444 0.29
445 0.3
446 0.27
447 0.27
448 0.26
449 0.3
450 0.29
451 0.26
452 0.25
453 0.2
454 0.18
455 0.15
456 0.14
457 0.1