Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6GCY3

Protein Details
Accession A0A0K6GCY3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-51GGFPKPHRSGSRRLRWRGPHATQKRPPAFRBasic
NLS Segment(s)
PositionSequence
26-46KPHRSGSRRLRWRGPHATQKR
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MGVSHTRGRAPPVQPSLLCSCGGFPKPHRSGSRRLRWRGPHATQKRPPAFRPLSDPLSQKLYEALSKDLNRWEKCTEYAVALETARDCALDYRAAIYMLAEVLVSPNGAPILGNHAYNSYHQELEALPSEFTSLGERFGKKWLDMSDHQIKIIPHSSQQGFRLEIAWKAPHLGKQVGAIVKTKVDEESSNSKFVEGDNKAFIDIPYSGGTKNFKVTVSVLTCDATMGDGKSGAFDEAKYGFSSLGEPAHTTMEVVFDSGGVPFCLTHQNAGSKPKLPSLLKDLGYHASVEDIGRYPVLIMGNTTWWPIRYKDDREEIAVLGFDSANKLVRAIGVEKVRLGYILEGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.5
4 0.44
5 0.4
6 0.31
7 0.27
8 0.28
9 0.32
10 0.32
11 0.33
12 0.42
13 0.46
14 0.54
15 0.61
16 0.59
17 0.66
18 0.71
19 0.76
20 0.76
21 0.79
22 0.8
23 0.8
24 0.85
25 0.84
26 0.82
27 0.82
28 0.81
29 0.84
30 0.82
31 0.84
32 0.83
33 0.78
34 0.73
35 0.72
36 0.69
37 0.61
38 0.62
39 0.58
40 0.54
41 0.53
42 0.53
43 0.45
44 0.45
45 0.42
46 0.33
47 0.29
48 0.26
49 0.24
50 0.23
51 0.23
52 0.25
53 0.26
54 0.28
55 0.34
56 0.4
57 0.39
58 0.41
59 0.41
60 0.37
61 0.37
62 0.38
63 0.31
64 0.24
65 0.24
66 0.21
67 0.19
68 0.17
69 0.16
70 0.12
71 0.12
72 0.11
73 0.1
74 0.08
75 0.08
76 0.1
77 0.1
78 0.1
79 0.11
80 0.12
81 0.12
82 0.11
83 0.1
84 0.08
85 0.07
86 0.07
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.11
99 0.12
100 0.12
101 0.12
102 0.13
103 0.14
104 0.15
105 0.2
106 0.15
107 0.14
108 0.14
109 0.15
110 0.14
111 0.16
112 0.17
113 0.13
114 0.11
115 0.11
116 0.12
117 0.11
118 0.11
119 0.11
120 0.09
121 0.1
122 0.14
123 0.15
124 0.15
125 0.2
126 0.21
127 0.18
128 0.21
129 0.21
130 0.23
131 0.24
132 0.3
133 0.34
134 0.33
135 0.33
136 0.33
137 0.31
138 0.28
139 0.29
140 0.23
141 0.15
142 0.2
143 0.22
144 0.21
145 0.24
146 0.23
147 0.21
148 0.2
149 0.21
150 0.16
151 0.16
152 0.15
153 0.13
154 0.11
155 0.12
156 0.13
157 0.14
158 0.16
159 0.16
160 0.14
161 0.15
162 0.18
163 0.17
164 0.17
165 0.15
166 0.13
167 0.13
168 0.13
169 0.12
170 0.09
171 0.09
172 0.09
173 0.13
174 0.2
175 0.21
176 0.23
177 0.22
178 0.22
179 0.21
180 0.2
181 0.24
182 0.18
183 0.18
184 0.18
185 0.18
186 0.18
187 0.18
188 0.18
189 0.12
190 0.1
191 0.1
192 0.1
193 0.11
194 0.11
195 0.12
196 0.15
197 0.13
198 0.15
199 0.15
200 0.14
201 0.14
202 0.15
203 0.19
204 0.19
205 0.19
206 0.18
207 0.17
208 0.16
209 0.15
210 0.13
211 0.08
212 0.07
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.07
219 0.07
220 0.06
221 0.06
222 0.08
223 0.09
224 0.1
225 0.1
226 0.1
227 0.1
228 0.1
229 0.11
230 0.09
231 0.1
232 0.09
233 0.09
234 0.1
235 0.11
236 0.11
237 0.1
238 0.09
239 0.09
240 0.08
241 0.08
242 0.07
243 0.05
244 0.06
245 0.06
246 0.07
247 0.05
248 0.06
249 0.05
250 0.07
251 0.12
252 0.13
253 0.14
254 0.17
255 0.22
256 0.25
257 0.32
258 0.33
259 0.33
260 0.34
261 0.36
262 0.41
263 0.37
264 0.37
265 0.39
266 0.43
267 0.4
268 0.41
269 0.39
270 0.34
271 0.33
272 0.29
273 0.22
274 0.15
275 0.14
276 0.12
277 0.11
278 0.1
279 0.1
280 0.1
281 0.1
282 0.09
283 0.11
284 0.12
285 0.1
286 0.1
287 0.11
288 0.13
289 0.14
290 0.15
291 0.14
292 0.15
293 0.17
294 0.18
295 0.26
296 0.32
297 0.38
298 0.45
299 0.52
300 0.53
301 0.54
302 0.54
303 0.45
304 0.38
305 0.31
306 0.23
307 0.17
308 0.14
309 0.1
310 0.1
311 0.11
312 0.13
313 0.12
314 0.13
315 0.12
316 0.13
317 0.16
318 0.16
319 0.22
320 0.24
321 0.25
322 0.26
323 0.27
324 0.26
325 0.23
326 0.22
327 0.18