FuNGI

A0A0K6G434

Protein Details

Accession

A0A0K6G434

Localization Confidence

Medium

Confidence Score

11.9

NoLS Segment(s)

Position	Sequence	Protein Nature
42-66	DDDGPPSKKKVVKRKPTTGLKINSG	Hydrophilic

NLS Segment(s)

Position	Sequence
46-57	PPSKKKVVKRKP
581-601	PRKPPGTPRASRGGVGRTKKR

Subcellular Location(s)

mito 19, nucl 5.5, cyto_nucl 4

Family & Domain DBs

InterPro	View protein in InterPro IPR013218 Dsn1/Mis13
Gene Ontology	GO:0000444 C:MIS12/MIND type complex GO:0051301 P:cell division GO:0007059 P:chromosome segregation
Pfam	View protein in Pfam PF08202 MIS13

Amino Acid Sequences

MIRTPPLRPPPAPLVDAVTKQLSTMTTSVSRSSSTISKRKADDDGPPSKKKVVKRKPTTGLKINSGPAPMVRSSSQLGQSTSRPPSALAQHPRTSHTPPTSDAEPSRRPIRQAPPSPPVPAIIAARARGESLPPVDPTPVRAPSRTGSVSRTISAPVNKGKGKARLPGLGIPVVIEEEETQDRWLAGQRSELAGRERDNERRAGTSRISTLNFPSSATSSTPARKRPADHSASSSSALSRAVLDSTQPVPISDTPVIVRNREIRQASQSRRRSSLSSRAAPHASVPNDTFYRHVDPDLPDSLRLRQVLCWTATRASDKPPSKPSAIVQDYLKSIQSQATKRLASGQIDTSITPSRTSHSNKPLPPHPKNVTNAQAISKLEAYNQACQAEDNAWSELISAYNSQQAQVVAALGTTAEKEPKEIELDDQWREGMQLVKEVLHTVKEGVGDGTEADDEMSDGEHEIVDAIGSLEPLVHEAYESAYRMDQFCTKAYVHLDHVFGTLAGTLRQRTAPQSALVPKDETGRMLGVGSGASVDTMDLLRAVASSRGGGSGGRVQVNGVPAKALNEALQKVTPVTAAPTPRKPPGTPRASRGGVGRTKKR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.44
2	0.42
3	0.42
4	0.38
5	0.32
6	0.26
7	0.25
8	0.26
9	0.2
10	0.19
11	0.18
12	0.19
13	0.2
14	0.22
15	0.25
16	0.24
17	0.24
18	0.22
19	0.25
20	0.28
21	0.33
22	0.4
23	0.44
24	0.5
25	0.52
26	0.56
27	0.58
28	0.54
29	0.55
30	0.55
31	0.59
32	0.6
33	0.62
34	0.61
35	0.62
36	0.63
37	0.63
38	0.65
39	0.66
40	0.69
41	0.74
42	0.82
43	0.85
44	0.9
45	0.9
46	0.88
47	0.84
48	0.79
49	0.74
50	0.67
51	0.59
52	0.49
53	0.41
54	0.33
55	0.3
56	0.24
57	0.22
58	0.2
59	0.2
60	0.22
61	0.25
62	0.29
63	0.29
64	0.3
65	0.3
66	0.33
67	0.37
68	0.38
69	0.35
70	0.3
71	0.28
72	0.32
73	0.36
74	0.41
75	0.44
76	0.47
77	0.51
78	0.53
79	0.56
80	0.55
81	0.53
82	0.52
83	0.48
84	0.43
85	0.41
86	0.44
87	0.42
88	0.42
89	0.42
90	0.41
91	0.4
92	0.43
93	0.47
94	0.44
95	0.46
96	0.49
97	0.54
98	0.57
99	0.61
100	0.63
101	0.63
102	0.64
103	0.63
104	0.55
105	0.47
106	0.38
107	0.32
108	0.25
109	0.23
110	0.22
111	0.2
112	0.21
113	0.2
114	0.19
115	0.17
116	0.17
117	0.15
118	0.16
119	0.17
120	0.18
121	0.19
122	0.2
123	0.2
124	0.24
125	0.26
126	0.3
127	0.3
128	0.29
129	0.32
130	0.31
131	0.37
132	0.35
133	0.31
134	0.28
135	0.32
136	0.33
137	0.31
138	0.3
139	0.25
140	0.27
141	0.27
142	0.29
143	0.28
144	0.32
145	0.33
146	0.36
147	0.4
148	0.44
149	0.44
150	0.46
151	0.45
152	0.43
153	0.44
154	0.44
155	0.41
156	0.33
157	0.29
158	0.23
159	0.19
160	0.15
161	0.12
162	0.08
163	0.06
164	0.08
165	0.09
166	0.09
167	0.09
168	0.1
169	0.1
170	0.1
171	0.15
172	0.14
173	0.14
174	0.16
175	0.17
176	0.19
177	0.2
178	0.22
179	0.2
180	0.2
181	0.21
182	0.23
183	0.25
184	0.29
185	0.31
186	0.32
187	0.31
188	0.33
189	0.34
190	0.33
191	0.31
192	0.27
193	0.28
194	0.29
195	0.28
196	0.25
197	0.26
198	0.25
199	0.23
200	0.21
201	0.19
202	0.16
203	0.16
204	0.16
205	0.15
206	0.15
207	0.22
208	0.26
209	0.3
210	0.34
211	0.36
212	0.38
213	0.43
214	0.49
215	0.48
216	0.45
217	0.45
218	0.43
219	0.41
220	0.39
221	0.32
222	0.23
223	0.18
224	0.16
225	0.12
226	0.08
227	0.07
228	0.07
229	0.07
230	0.07
231	0.09
232	0.09
233	0.11
234	0.1
235	0.1
236	0.12
237	0.12
238	0.16
239	0.14
240	0.14
241	0.13
242	0.2
243	0.21
244	0.19
245	0.21
246	0.22
247	0.24
248	0.29
249	0.3
250	0.25
251	0.32
252	0.4
253	0.45
254	0.49
255	0.54
256	0.52
257	0.54
258	0.54
259	0.5
260	0.47
261	0.5
262	0.47
263	0.45
264	0.44
265	0.44
266	0.43
267	0.39
268	0.36
269	0.31
270	0.24
271	0.21
272	0.19
273	0.18
274	0.18
275	0.19
276	0.18
277	0.15
278	0.18
279	0.16
280	0.16
281	0.16
282	0.17
283	0.2
284	0.21
285	0.19
286	0.17
287	0.17
288	0.18
289	0.18
290	0.17
291	0.15
292	0.13
293	0.16
294	0.18
295	0.18
296	0.18
297	0.17
298	0.18
299	0.18
300	0.2
301	0.19
302	0.2
303	0.28
304	0.29
305	0.32
306	0.35
307	0.38
308	0.35
309	0.36
310	0.33
311	0.34
312	0.34
313	0.31
314	0.27
315	0.25
316	0.25
317	0.24
318	0.23
319	0.13
320	0.12
321	0.14
322	0.19
323	0.19
324	0.23
325	0.28
326	0.27
327	0.27
328	0.32
329	0.31
330	0.26
331	0.26
332	0.22
333	0.19
334	0.19
335	0.19
336	0.17
337	0.17
338	0.16
339	0.15
340	0.14
341	0.13
342	0.19
343	0.25
344	0.3
345	0.37
346	0.44
347	0.46
348	0.51
349	0.57
350	0.61
351	0.6
352	0.61
353	0.56
354	0.55
355	0.56
356	0.56
357	0.53
358	0.46
359	0.44
360	0.36
361	0.35
362	0.29
363	0.27
364	0.22
365	0.17
366	0.15
367	0.2
368	0.2
369	0.2
370	0.21
371	0.2
372	0.19
373	0.19
374	0.19
375	0.14
376	0.14
377	0.12
378	0.11
379	0.11
380	0.1
381	0.11
382	0.1
383	0.09
384	0.08
385	0.07
386	0.07
387	0.11
388	0.11
389	0.11
390	0.12
391	0.12
392	0.11
393	0.11
394	0.1
395	0.06
396	0.06
397	0.05
398	0.04
399	0.04
400	0.04
401	0.05
402	0.07
403	0.07
404	0.08
405	0.1
406	0.11
407	0.14
408	0.13
409	0.15
410	0.2
411	0.23
412	0.24
413	0.23
414	0.22
415	0.19
416	0.19
417	0.18
418	0.15
419	0.12
420	0.14
421	0.14
422	0.15
423	0.15
424	0.16
425	0.15
426	0.12
427	0.13
428	0.1
429	0.11
430	0.11
431	0.11
432	0.09
433	0.09
434	0.08
435	0.08
436	0.08
437	0.06
438	0.05
439	0.05
440	0.05
441	0.04
442	0.04
443	0.05
444	0.04
445	0.05
446	0.05
447	0.05
448	0.05
449	0.05
450	0.04
451	0.04
452	0.04
453	0.04
454	0.04
455	0.04
456	0.04
457	0.04
458	0.04
459	0.06
460	0.06
461	0.05
462	0.05
463	0.05
464	0.07
465	0.1
466	0.11
467	0.1
468	0.11
469	0.13
470	0.14
471	0.16
472	0.18
473	0.18
474	0.19
475	0.22
476	0.21
477	0.23
478	0.26
479	0.27
480	0.28
481	0.29
482	0.28
483	0.25
484	0.25
485	0.22
486	0.18
487	0.15
488	0.12
489	0.09
490	0.1
491	0.11
492	0.12
493	0.13
494	0.15
495	0.17
496	0.19
497	0.24
498	0.24
499	0.24
500	0.29
501	0.34
502	0.36
503	0.36
504	0.35
505	0.31
506	0.34
507	0.33
508	0.27
509	0.23
510	0.19
511	0.17
512	0.16
513	0.15
514	0.1
515	0.09
516	0.08
517	0.06
518	0.05
519	0.05
520	0.04
521	0.04
522	0.05
523	0.05
524	0.05
525	0.05
526	0.05
527	0.05
528	0.05
529	0.07
530	0.07
531	0.08
532	0.09
533	0.09
534	0.1
535	0.1
536	0.1
537	0.12
538	0.17
539	0.2
540	0.21
541	0.2
542	0.21
543	0.23
544	0.28
545	0.27
546	0.2
547	0.18
548	0.17
549	0.19
550	0.2
551	0.18
552	0.17
553	0.2
554	0.22
555	0.23
556	0.24
557	0.23
558	0.22
559	0.22
560	0.19
561	0.13
562	0.16
563	0.18
564	0.25
565	0.32
566	0.39
567	0.44
568	0.51
569	0.56
570	0.55
571	0.6
572	0.63
573	0.67
574	0.64
575	0.64
576	0.66
577	0.63
578	0.63
579	0.58
580	0.57
581	0.55

A0A0K6G434

3D AlphaFold-predicted Structure Viewer