Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G434

Protein Details
Accession A0A0K6G434   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-66DDDGPPSKKKVVKRKPTTGLKINSGHydrophilic
NLS Segment(s)
PositionSequence
46-57PPSKKKVVKRKP
581-601PRKPPGTPRASRGGVGRTKKR
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MIRTPPLRPPPAPLVDAVTKQLSTMTTSVSRSSSTISKRKADDDGPPSKKKVVKRKPTTGLKINSGPAPMVRSSSQLGQSTSRPPSALAQHPRTSHTPPTSDAEPSRRPIRQAPPSPPVPAIIAARARGESLPPVDPTPVRAPSRTGSVSRTISAPVNKGKGKARLPGLGIPVVIEEEETQDRWLAGQRSELAGRERDNERRAGTSRISTLNFPSSATSSTPARKRPADHSASSSSALSRAVLDSTQPVPISDTPVIVRNREIRQASQSRRRSSLSSRAAPHASVPNDTFYRHVDPDLPDSLRLRQVLCWTATRASDKPPSKPSAIVQDYLKSIQSQATKRLASGQIDTSITPSRTSHSNKPLPPHPKNVTNAQAISKLEAYNQACQAEDNAWSELISAYNSQQAQVVAALGTTAEKEPKEIELDDQWREGMQLVKEVLHTVKEGVGDGTEADDEMSDGEHEIVDAIGSLEPLVHEAYESAYRMDQFCTKAYVHLDHVFGTLAGTLRQRTAPQSALVPKDETGRMLGVGSGASVDTMDLLRAVASSRGGGSGGRVQVNGVPAKALNEALQKVTPVTAAPTPRKPPGTPRASRGGVGRTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.42
4 0.38
5 0.32
6 0.26
7 0.25
8 0.26
9 0.2
10 0.19
11 0.18
12 0.19
13 0.2
14 0.22
15 0.25
16 0.24
17 0.24
18 0.22
19 0.25
20 0.28
21 0.33
22 0.4
23 0.44
24 0.5
25 0.52
26 0.56
27 0.58
28 0.54
29 0.55
30 0.55
31 0.59
32 0.6
33 0.62
34 0.61
35 0.62
36 0.63
37 0.63
38 0.65
39 0.66
40 0.69
41 0.74
42 0.82
43 0.85
44 0.9
45 0.9
46 0.88
47 0.84
48 0.79
49 0.74
50 0.67
51 0.59
52 0.49
53 0.41
54 0.33
55 0.3
56 0.24
57 0.22
58 0.2
59 0.2
60 0.22
61 0.25
62 0.29
63 0.29
64 0.3
65 0.3
66 0.33
67 0.37
68 0.38
69 0.35
70 0.3
71 0.28
72 0.32
73 0.36
74 0.41
75 0.44
76 0.47
77 0.51
78 0.53
79 0.56
80 0.55
81 0.53
82 0.52
83 0.48
84 0.43
85 0.41
86 0.44
87 0.42
88 0.42
89 0.42
90 0.41
91 0.4
92 0.43
93 0.47
94 0.44
95 0.46
96 0.49
97 0.54
98 0.57
99 0.61
100 0.63
101 0.63
102 0.64
103 0.63
104 0.55
105 0.47
106 0.38
107 0.32
108 0.25
109 0.23
110 0.22
111 0.2
112 0.21
113 0.2
114 0.19
115 0.17
116 0.17
117 0.15
118 0.16
119 0.17
120 0.18
121 0.19
122 0.2
123 0.2
124 0.24
125 0.26
126 0.3
127 0.3
128 0.29
129 0.32
130 0.31
131 0.37
132 0.35
133 0.31
134 0.28
135 0.32
136 0.33
137 0.31
138 0.3
139 0.25
140 0.27
141 0.27
142 0.29
143 0.28
144 0.32
145 0.33
146 0.36
147 0.4
148 0.44
149 0.44
150 0.46
151 0.45
152 0.43
153 0.44
154 0.44
155 0.41
156 0.33
157 0.29
158 0.23
159 0.19
160 0.15
161 0.12
162 0.08
163 0.06
164 0.08
165 0.09
166 0.09
167 0.09
168 0.1
169 0.1
170 0.1
171 0.15
172 0.14
173 0.14
174 0.16
175 0.17
176 0.19
177 0.2
178 0.22
179 0.2
180 0.2
181 0.21
182 0.23
183 0.25
184 0.29
185 0.31
186 0.32
187 0.31
188 0.33
189 0.34
190 0.33
191 0.31
192 0.27
193 0.28
194 0.29
195 0.28
196 0.25
197 0.26
198 0.25
199 0.23
200 0.21
201 0.19
202 0.16
203 0.16
204 0.16
205 0.15
206 0.15
207 0.22
208 0.26
209 0.3
210 0.34
211 0.36
212 0.38
213 0.43
214 0.49
215 0.48
216 0.45
217 0.45
218 0.43
219 0.41
220 0.39
221 0.32
222 0.23
223 0.18
224 0.16
225 0.12
226 0.08
227 0.07
228 0.07
229 0.07
230 0.07
231 0.09
232 0.09
233 0.11
234 0.1
235 0.1
236 0.12
237 0.12
238 0.16
239 0.14
240 0.14
241 0.13
242 0.2
243 0.21
244 0.19
245 0.21
246 0.22
247 0.24
248 0.29
249 0.3
250 0.25
251 0.32
252 0.4
253 0.45
254 0.49
255 0.54
256 0.52
257 0.54
258 0.54
259 0.5
260 0.47
261 0.5
262 0.47
263 0.45
264 0.44
265 0.44
266 0.43
267 0.39
268 0.36
269 0.31
270 0.24
271 0.21
272 0.19
273 0.18
274 0.18
275 0.19
276 0.18
277 0.15
278 0.18
279 0.16
280 0.16
281 0.16
282 0.17
283 0.2
284 0.21
285 0.19
286 0.17
287 0.17
288 0.18
289 0.18
290 0.17
291 0.15
292 0.13
293 0.16
294 0.18
295 0.18
296 0.18
297 0.17
298 0.18
299 0.18
300 0.2
301 0.19
302 0.2
303 0.28
304 0.29
305 0.32
306 0.35
307 0.38
308 0.35
309 0.36
310 0.33
311 0.34
312 0.34
313 0.31
314 0.27
315 0.25
316 0.25
317 0.24
318 0.23
319 0.13
320 0.12
321 0.14
322 0.19
323 0.19
324 0.23
325 0.28
326 0.27
327 0.27
328 0.32
329 0.31
330 0.26
331 0.26
332 0.22
333 0.19
334 0.19
335 0.19
336 0.17
337 0.17
338 0.16
339 0.15
340 0.14
341 0.13
342 0.19
343 0.25
344 0.3
345 0.37
346 0.44
347 0.46
348 0.51
349 0.57
350 0.61
351 0.6
352 0.61
353 0.56
354 0.55
355 0.56
356 0.56
357 0.53
358 0.46
359 0.44
360 0.36
361 0.35
362 0.29
363 0.27
364 0.22
365 0.17
366 0.15
367 0.2
368 0.2
369 0.2
370 0.21
371 0.2
372 0.19
373 0.19
374 0.19
375 0.14
376 0.14
377 0.12
378 0.11
379 0.11
380 0.1
381 0.11
382 0.1
383 0.09
384 0.08
385 0.07
386 0.07
387 0.11
388 0.11
389 0.11
390 0.12
391 0.12
392 0.11
393 0.11
394 0.1
395 0.06
396 0.06
397 0.05
398 0.04
399 0.04
400 0.04
401 0.05
402 0.07
403 0.07
404 0.08
405 0.1
406 0.11
407 0.14
408 0.13
409 0.15
410 0.2
411 0.23
412 0.24
413 0.23
414 0.22
415 0.19
416 0.19
417 0.18
418 0.15
419 0.12
420 0.14
421 0.14
422 0.15
423 0.15
424 0.16
425 0.15
426 0.12
427 0.13
428 0.1
429 0.11
430 0.11
431 0.11
432 0.09
433 0.09
434 0.08
435 0.08
436 0.08
437 0.06
438 0.05
439 0.05
440 0.05
441 0.04
442 0.04
443 0.05
444 0.04
445 0.05
446 0.05
447 0.05
448 0.05
449 0.05
450 0.04
451 0.04
452 0.04
453 0.04
454 0.04
455 0.04
456 0.04
457 0.04
458 0.04
459 0.06
460 0.06
461 0.05
462 0.05
463 0.05
464 0.07
465 0.1
466 0.11
467 0.1
468 0.11
469 0.13
470 0.14
471 0.16
472 0.18
473 0.18
474 0.19
475 0.22
476 0.21
477 0.23
478 0.26
479 0.27
480 0.28
481 0.29
482 0.28
483 0.25
484 0.25
485 0.22
486 0.18
487 0.15
488 0.12
489 0.09
490 0.1
491 0.11
492 0.12
493 0.13
494 0.15
495 0.17
496 0.19
497 0.24
498 0.24
499 0.24
500 0.29
501 0.34
502 0.36
503 0.36
504 0.35
505 0.31
506 0.34
507 0.33
508 0.27
509 0.23
510 0.19
511 0.17
512 0.16
513 0.15
514 0.1
515 0.09
516 0.08
517 0.06
518 0.05
519 0.05
520 0.04
521 0.04
522 0.05
523 0.05
524 0.05
525 0.05
526 0.05
527 0.05
528 0.05
529 0.07
530 0.07
531 0.08
532 0.09
533 0.09
534 0.1
535 0.1
536 0.1
537 0.12
538 0.17
539 0.2
540 0.21
541 0.2
542 0.21
543 0.23
544 0.28
545 0.27
546 0.2
547 0.18
548 0.17
549 0.19
550 0.2
551 0.18
552 0.17
553 0.2
554 0.22
555 0.23
556 0.24
557 0.23
558 0.22
559 0.22
560 0.19
561 0.13
562 0.16
563 0.18
564 0.25
565 0.32
566 0.39
567 0.44
568 0.51
569 0.56
570 0.55
571 0.6
572 0.63
573 0.67
574 0.64
575 0.64
576 0.66
577 0.63
578 0.63
579 0.58
580 0.57
581 0.55