Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G8G7

Protein Details
Accession A0A0K6G8G7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
236-260RDESDKLREWSRKRRLRATQCYLVSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018750  DUF2306_membrane  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10067  DUF2306  
Amino Acid Sequences MSFQRLLATTTPVEGYWYQKSSWKIFVILHIVTTIPASFFSVFCFLPITFKMWPRLHGAAGYLVSLLLIVSCVAGGIVARRAQGGELAVQLGYYILSSGAIASVVMGCIEGWRTAFDAHREWMLRAWVYNGALVTTHVTVAVSARIIARIASYYTTMRCSEIRYVINSDRIPTDFPECSTPEAIANPDGYYVAVKAVWEQERLGQSSAIRVTFGMSMLLAIVLHCVGVEIYIRATRDESDKLREWSRKRRLRATQCYLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.24
4 0.25
5 0.25
6 0.29
7 0.35
8 0.35
9 0.4
10 0.37
11 0.33
12 0.32
13 0.36
14 0.36
15 0.31
16 0.27
17 0.22
18 0.2
19 0.17
20 0.17
21 0.12
22 0.07
23 0.07
24 0.09
25 0.1
26 0.1
27 0.12
28 0.14
29 0.13
30 0.13
31 0.16
32 0.13
33 0.16
34 0.17
35 0.18
36 0.19
37 0.23
38 0.32
39 0.31
40 0.33
41 0.36
42 0.37
43 0.34
44 0.31
45 0.28
46 0.22
47 0.21
48 0.19
49 0.12
50 0.1
51 0.08
52 0.08
53 0.06
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.03
60 0.02
61 0.03
62 0.03
63 0.04
64 0.06
65 0.08
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.09
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.05
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.04
98 0.04
99 0.05
100 0.06
101 0.07
102 0.08
103 0.11
104 0.12
105 0.12
106 0.15
107 0.15
108 0.15
109 0.15
110 0.15
111 0.13
112 0.11
113 0.12
114 0.1
115 0.1
116 0.1
117 0.09
118 0.07
119 0.07
120 0.07
121 0.07
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.08
140 0.09
141 0.09
142 0.12
143 0.12
144 0.13
145 0.14
146 0.16
147 0.17
148 0.21
149 0.22
150 0.21
151 0.26
152 0.26
153 0.31
154 0.29
155 0.27
156 0.24
157 0.23
158 0.22
159 0.19
160 0.21
161 0.16
162 0.17
163 0.2
164 0.19
165 0.21
166 0.2
167 0.19
168 0.15
169 0.16
170 0.16
171 0.13
172 0.13
173 0.1
174 0.1
175 0.1
176 0.09
177 0.08
178 0.07
179 0.06
180 0.06
181 0.06
182 0.07
183 0.13
184 0.14
185 0.15
186 0.15
187 0.19
188 0.22
189 0.25
190 0.24
191 0.2
192 0.18
193 0.22
194 0.24
195 0.19
196 0.16
197 0.14
198 0.15
199 0.14
200 0.14
201 0.1
202 0.07
203 0.07
204 0.07
205 0.07
206 0.05
207 0.04
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.05
216 0.05
217 0.07
218 0.1
219 0.11
220 0.12
221 0.13
222 0.15
223 0.19
224 0.25
225 0.27
226 0.32
227 0.37
228 0.41
229 0.48
230 0.55
231 0.59
232 0.64
233 0.71
234 0.73
235 0.76
236 0.81
237 0.84
238 0.87
239 0.89
240 0.87