Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6GC88

Protein Details
Accession A0A0K6GC88   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
171-196ALTGDDKERKKKKKKRPIDPSQPSAPBasic
NLS Segment(s)
PositionSequence
177-187KERKKKKKKRP
305-305K
Subcellular Location(s) cyto 9, nucl 8, mito 6, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MTQPNAVAGPSHAGQSSAHNDLSIATALATGIGGLSLAAYLAPDPAPPRPRSSIHPTQDLLGRYGILPVYDEFVRPFTTSAPSTIEDKGKRKEDEDEGRHGPKEGLFQHGYKAFIKDLGLGKHNHKKDTFLTDLMQMPEKQPAQVTKLDRTTLVHAFRLKEGGVPGFNTSALTGDDKERKKKKKKRPIDPSQPSAPATPAAGPSTPGAAAPIRRPTGPLPPSQLASSHVPSTQQPPQRPPQQQQPPQRHPLPANPKAAAAAARPLGAGAGTVKRKDREDGVNGHVGNMGGNMGPAGGTGLKPAKKRKMDPMAFAPGHHHHAQPVQQPTPHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.24
4 0.23
5 0.23
6 0.21
7 0.21
8 0.21
9 0.22
10 0.17
11 0.12
12 0.08
13 0.08
14 0.08
15 0.08
16 0.07
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.02
24 0.03
25 0.03
26 0.03
27 0.03
28 0.05
29 0.05
30 0.07
31 0.09
32 0.16
33 0.24
34 0.26
35 0.32
36 0.36
37 0.39
38 0.45
39 0.52
40 0.55
41 0.53
42 0.58
43 0.53
44 0.5
45 0.52
46 0.46
47 0.38
48 0.28
49 0.23
50 0.17
51 0.18
52 0.15
53 0.1
54 0.1
55 0.09
56 0.11
57 0.11
58 0.12
59 0.11
60 0.13
61 0.14
62 0.13
63 0.14
64 0.12
65 0.16
66 0.16
67 0.17
68 0.19
69 0.19
70 0.21
71 0.24
72 0.29
73 0.31
74 0.36
75 0.42
76 0.45
77 0.45
78 0.44
79 0.47
80 0.49
81 0.53
82 0.52
83 0.51
84 0.49
85 0.5
86 0.48
87 0.43
88 0.35
89 0.26
90 0.28
91 0.23
92 0.24
93 0.23
94 0.23
95 0.26
96 0.28
97 0.29
98 0.24
99 0.24
100 0.18
101 0.17
102 0.17
103 0.18
104 0.19
105 0.19
106 0.21
107 0.22
108 0.28
109 0.35
110 0.38
111 0.37
112 0.34
113 0.35
114 0.36
115 0.4
116 0.37
117 0.3
118 0.28
119 0.27
120 0.29
121 0.26
122 0.25
123 0.18
124 0.16
125 0.19
126 0.18
127 0.16
128 0.16
129 0.16
130 0.17
131 0.22
132 0.25
133 0.24
134 0.27
135 0.27
136 0.25
137 0.25
138 0.26
139 0.25
140 0.24
141 0.22
142 0.22
143 0.22
144 0.22
145 0.22
146 0.18
147 0.14
148 0.13
149 0.12
150 0.1
151 0.1
152 0.1
153 0.09
154 0.09
155 0.08
156 0.07
157 0.06
158 0.07
159 0.07
160 0.07
161 0.1
162 0.18
163 0.21
164 0.3
165 0.38
166 0.48
167 0.58
168 0.68
169 0.76
170 0.8
171 0.87
172 0.89
173 0.92
174 0.92
175 0.93
176 0.9
177 0.85
178 0.78
179 0.7
180 0.6
181 0.49
182 0.39
183 0.28
184 0.21
185 0.16
186 0.12
187 0.11
188 0.1
189 0.1
190 0.1
191 0.1
192 0.09
193 0.08
194 0.09
195 0.09
196 0.1
197 0.13
198 0.18
199 0.19
200 0.19
201 0.21
202 0.22
203 0.3
204 0.31
205 0.31
206 0.32
207 0.32
208 0.34
209 0.32
210 0.31
211 0.24
212 0.26
213 0.25
214 0.2
215 0.18
216 0.18
217 0.19
218 0.24
219 0.28
220 0.31
221 0.33
222 0.38
223 0.46
224 0.54
225 0.59
226 0.59
227 0.62
228 0.67
229 0.71
230 0.76
231 0.78
232 0.76
233 0.78
234 0.77
235 0.71
236 0.64
237 0.65
238 0.65
239 0.61
240 0.59
241 0.52
242 0.48
243 0.43
244 0.41
245 0.32
246 0.23
247 0.2
248 0.15
249 0.14
250 0.14
251 0.13
252 0.12
253 0.1
254 0.09
255 0.07
256 0.13
257 0.16
258 0.2
259 0.24
260 0.28
261 0.3
262 0.33
263 0.37
264 0.38
265 0.41
266 0.44
267 0.44
268 0.48
269 0.45
270 0.42
271 0.37
272 0.29
273 0.23
274 0.18
275 0.13
276 0.07
277 0.07
278 0.06
279 0.04
280 0.04
281 0.04
282 0.05
283 0.05
284 0.06
285 0.1
286 0.17
287 0.21
288 0.28
289 0.38
290 0.46
291 0.54
292 0.61
293 0.67
294 0.72
295 0.74
296 0.75
297 0.73
298 0.73
299 0.65
300 0.6
301 0.55
302 0.48
303 0.48
304 0.43
305 0.36
306 0.29
307 0.35
308 0.41
309 0.42
310 0.46
311 0.45