FuNGI

A0A0K6G2A3

Protein Details

Accession

A0A0K6G2A3

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
23-66	LSELPKQTTKKPPEFNRLQRFPKEPEKLTLKKTYERERQRQLII	Hydrophilic
524-544	TDGRGRGKIFRKRIQGGERKT	Basic

NLS Segment(s)

Position	Sequence
512-519	GRAGRAGK
526-546	GRGRGKIFRKRIQGGERKTAG

Subcellular Location(s)

cysk 11, cyto 8.5, cyto_mito 7.666, cyto_nucl 6.333, mito 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011545 DEAD/DEAH_box_helicase_dom IPR014001 Helicase_ATP-bd IPR001650 Helicase_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0005524 F:ATP binding GO:0004386 F:helicase activity GO:0016787 F:hydrolase activity GO:0003723 F:RNA binding
Pfam	View protein in Pfam PF00270 DEAD PF00271 Helicase_C
PROSITE	View protein in PROSITE PS51192 HELICASE_ATP_BIND_1 PS51194 HELICASE_CTER
CDD	cd00268 DEADc

Amino Acid Sequences

MALAGEVNNFSGVIGFVPARARLSELPKQTTKKPPEFNRLQRFPKEPEKLTLKKTYERERQRQLIIPLPDSGPQDTLHLASTGLRFSSPPLLPGLVSQIRELLGNRARPTPVQTLSLTHFFRDGDVRGVPDGTLLAAETGSGKSLAYLLPVVQALKAGENSTTDPGNLASPRALILVPTHELARQVKSTLSHLTHAPDTKLRTVCVSTGSANSLSRDGPQSAALPLGDGGEFHISPPEQTRYSPDVVVGTPAKILDLTHPGGRYSVGPMRPTYEDKIKREFERDVKMGYERIEWVVVDEADVLFDPDFALWTEAILSDIPKPYNLVLATATISAHLSKYLSAHHPTLTRLTTPQLHRLPPSLQTEYVEWDRRPGNRNPMVLKKLKDTWAEEARQHPGWKERSKVLIFCNRSGKVKELGEYLRGEGIKCVSLTSDSENRQRGSNKHISAFLKPLPSANRKQVSDLDSQDSPDVLVTTSLLSRGLDFTPAVRSVFIVDEPRNEVDFIHRAGRAGRAGRAGKVVVFTDGRGRGKIFRKRIQGGERKTAGVRKISAFDAA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.08
3	0.09
4	0.12
5	0.13
6	0.15
7	0.15
8	0.19
9	0.22
10	0.3
11	0.36
12	0.41
13	0.47
14	0.53
15	0.58
16	0.62
17	0.67
18	0.69
19	0.71
20	0.74
21	0.76
22	0.79
23	0.85
24	0.87
25	0.88
26	0.87
27	0.86
28	0.83
29	0.8
30	0.77
31	0.76
32	0.74
33	0.67
34	0.66
35	0.67
36	0.66
37	0.67
38	0.69
39	0.64
40	0.63
41	0.68
42	0.7
43	0.71
44	0.75
45	0.78
46	0.79
47	0.81
48	0.78
49	0.76
50	0.7
51	0.68
52	0.61
53	0.54
54	0.46
55	0.4
56	0.39
57	0.34
58	0.3
59	0.24
60	0.2
61	0.2
62	0.18
63	0.18
64	0.15
65	0.13
66	0.12
67	0.13
68	0.14
69	0.13
70	0.13
71	0.12
72	0.11
73	0.14
74	0.21
75	0.19
76	0.19
77	0.2
78	0.2
79	0.2
80	0.2
81	0.25
82	0.21
83	0.21
84	0.2
85	0.19
86	0.19
87	0.2
88	0.2
89	0.21
90	0.23
91	0.27
92	0.29
93	0.31
94	0.32
95	0.33
96	0.37
97	0.37
98	0.33
99	0.32
100	0.31
101	0.31
102	0.33
103	0.39
104	0.34
105	0.27
106	0.26
107	0.22
108	0.23
109	0.23
110	0.2
111	0.17
112	0.17
113	0.18
114	0.17
115	0.17
116	0.15
117	0.12
118	0.11
119	0.07
120	0.06
121	0.05
122	0.05
123	0.04
124	0.04
125	0.05
126	0.05
127	0.06
128	0.06
129	0.05
130	0.05
131	0.06
132	0.06
133	0.06
134	0.07
135	0.06
136	0.08
137	0.08
138	0.09
139	0.08
140	0.09
141	0.08
142	0.09
143	0.1
144	0.09
145	0.09
146	0.1
147	0.12
148	0.13
149	0.13
150	0.11
151	0.11
152	0.11
153	0.13
154	0.12
155	0.11
156	0.1
157	0.1
158	0.1
159	0.11
160	0.1
161	0.07
162	0.08
163	0.1
164	0.11
165	0.11
166	0.11
167	0.11
168	0.14
169	0.16
170	0.17
171	0.16
172	0.15
173	0.16
174	0.17
175	0.19
176	0.22
177	0.22
178	0.21
179	0.21
180	0.23
181	0.25
182	0.25
183	0.24
184	0.22
185	0.23
186	0.27
187	0.27
188	0.25
189	0.24
190	0.23
191	0.22
192	0.21
193	0.2
194	0.15
195	0.15
196	0.16
197	0.15
198	0.15
199	0.15
200	0.14
201	0.12
202	0.13
203	0.14
204	0.13
205	0.12
206	0.12
207	0.12
208	0.11
209	0.12
210	0.1
211	0.08
212	0.08
213	0.07
214	0.06
215	0.05
216	0.05
217	0.06
218	0.07
219	0.06
220	0.08
221	0.07
222	0.08
223	0.11
224	0.14
225	0.13
226	0.14
227	0.19
228	0.21
229	0.23
230	0.23
231	0.2
232	0.18
233	0.17
234	0.2
235	0.15
236	0.11
237	0.1
238	0.09
239	0.09
240	0.07
241	0.07
242	0.06
243	0.1
244	0.11
245	0.13
246	0.13
247	0.13
248	0.14
249	0.14
250	0.12
251	0.12
252	0.15
253	0.16
254	0.16
255	0.17
256	0.19
257	0.21
258	0.23
259	0.23
260	0.28
261	0.32
262	0.34
263	0.4
264	0.41
265	0.41
266	0.42
267	0.43
268	0.39
269	0.39
270	0.37
271	0.31
272	0.29
273	0.28
274	0.26
275	0.22
276	0.18
277	0.12
278	0.12
279	0.11
280	0.1
281	0.09
282	0.09
283	0.08
284	0.07
285	0.06
286	0.05
287	0.05
288	0.05
289	0.05
290	0.04
291	0.04
292	0.04
293	0.03
294	0.04
295	0.04
296	0.05
297	0.04
298	0.04
299	0.05
300	0.05
301	0.05
302	0.05
303	0.05
304	0.07
305	0.09
306	0.09
307	0.09
308	0.1
309	0.09
310	0.13
311	0.12
312	0.11
313	0.09
314	0.1
315	0.11
316	0.1
317	0.1
318	0.07
319	0.07
320	0.07
321	0.06
322	0.06
323	0.06
324	0.06
325	0.07
326	0.1
327	0.13
328	0.16
329	0.17
330	0.19
331	0.2
332	0.21
333	0.24
334	0.22
335	0.19
336	0.18
337	0.2
338	0.24
339	0.25
340	0.33
341	0.33
342	0.34
343	0.34
344	0.36
345	0.35
346	0.34
347	0.38
348	0.31
349	0.28
350	0.27
351	0.26
352	0.27
353	0.31
354	0.29
355	0.23
356	0.25
357	0.27
358	0.31
359	0.35
360	0.37
361	0.42
362	0.44
363	0.48
364	0.5
365	0.54
366	0.56
367	0.56
368	0.53
369	0.47
370	0.46
371	0.47
372	0.46
373	0.41
374	0.42
375	0.44
376	0.45
377	0.42
378	0.41
379	0.4
380	0.39
381	0.37
382	0.32
383	0.33
384	0.39
385	0.41
386	0.42
387	0.42
388	0.47
389	0.48
390	0.49
391	0.49
392	0.5
393	0.49
394	0.49
395	0.53
396	0.47
397	0.49
398	0.47
399	0.43
400	0.4
401	0.38
402	0.35
403	0.32
404	0.32
405	0.31
406	0.3
407	0.27
408	0.24
409	0.23
410	0.21
411	0.17
412	0.17
413	0.15
414	0.14
415	0.13
416	0.1
417	0.12
418	0.13
419	0.17
420	0.23
421	0.25
422	0.32
423	0.36
424	0.36
425	0.4
426	0.44
427	0.42
428	0.44
429	0.49
430	0.46
431	0.44
432	0.5
433	0.48
434	0.46
435	0.48
436	0.42
437	0.37
438	0.34
439	0.35
440	0.36
441	0.41
442	0.44
443	0.48
444	0.52
445	0.49
446	0.53
447	0.54
448	0.51
449	0.51
450	0.48
451	0.43
452	0.36
453	0.36
454	0.33
455	0.27
456	0.22
457	0.16
458	0.13
459	0.08
460	0.08
461	0.07
462	0.08
463	0.08
464	0.08
465	0.08
466	0.08
467	0.09
468	0.11
469	0.11
470	0.12
471	0.12
472	0.12
473	0.16
474	0.18
475	0.17
476	0.15
477	0.15
478	0.15
479	0.16
480	0.17
481	0.19
482	0.19
483	0.22
484	0.26
485	0.28
486	0.27
487	0.26
488	0.24
489	0.23
490	0.26
491	0.25
492	0.26
493	0.24
494	0.24
495	0.25
496	0.3
497	0.3
498	0.29
499	0.3
500	0.33
501	0.35
502	0.36
503	0.37
504	0.34
505	0.29
506	0.29
507	0.26
508	0.22
509	0.21
510	0.2
511	0.24
512	0.3
513	0.31
514	0.3
515	0.32
516	0.36
517	0.45
518	0.54
519	0.56
520	0.58
521	0.66
522	0.71
523	0.78
524	0.8
525	0.81
526	0.79
527	0.79
528	0.74
529	0.68
530	0.65
531	0.62
532	0.56
533	0.53
534	0.49
535	0.43
536	0.43

A0A0K6G2A3

3D AlphaFold-predicted Structure Viewer