Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FRU9

Protein Details
Accession Q6FRU9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
226-257DKETYTYIKKMKKQKKRQAKKEKLKKLKEKANBasic
NLS Segment(s)
PositionSequence
234-257KKMKKQKKRQAKKEKLKKLKEKAN
Subcellular Location(s) plas 14, mito 5, E.R. 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004728  Sec62  
IPR011553  Sec62_asco  
Gene Ontology GO:0031207  C:Sec62/Sec63 complex  
GO:0071256  C:translocon complex  
GO:0008320  F:protein transmembrane transporter activity  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
KEGG cgr:CAGL0H05731g  -  
Pfam View protein in Pfam  
PF03839  Sec62  
Amino Acid Sequences MDQSAVLAIASFVRNRSELKARKGLFQDKPTDFFRYKRFVRCLKSDAYKKKSLKQPDLYPPLPEDEEKFAELARGIFVEFIKNQLVVPGQKLHSYECKEHGLKPSKDYPHLIMSTKATLDDNEYYLWHYNPKTLTDYLIVFGVIGVILAFVCYPLWPASMRRGTYYLSLAAFGFLGVFFGVAIIRLIVFLISMLFIREKGGFWLFPNLFEDCGFFDSFKPLYGFGDKETYTYIKKMKKQKKRQAKKEKLKKLKEKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.32
5 0.38
6 0.45
7 0.53
8 0.52
9 0.58
10 0.63
11 0.67
12 0.65
13 0.64
14 0.65
15 0.59
16 0.62
17 0.58
18 0.57
19 0.5
20 0.47
21 0.47
22 0.47
23 0.49
24 0.54
25 0.59
26 0.61
27 0.65
28 0.67
29 0.65
30 0.63
31 0.67
32 0.68
33 0.7
34 0.68
35 0.71
36 0.68
37 0.72
38 0.73
39 0.74
40 0.74
41 0.72
42 0.73
43 0.74
44 0.78
45 0.71
46 0.64
47 0.55
48 0.49
49 0.42
50 0.34
51 0.26
52 0.22
53 0.23
54 0.22
55 0.2
56 0.16
57 0.16
58 0.15
59 0.13
60 0.08
61 0.07
62 0.06
63 0.07
64 0.07
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.11
71 0.11
72 0.13
73 0.11
74 0.14
75 0.16
76 0.16
77 0.18
78 0.19
79 0.2
80 0.25
81 0.28
82 0.28
83 0.27
84 0.33
85 0.32
86 0.35
87 0.41
88 0.44
89 0.42
90 0.43
91 0.48
92 0.45
93 0.46
94 0.45
95 0.39
96 0.34
97 0.35
98 0.31
99 0.25
100 0.23
101 0.21
102 0.19
103 0.17
104 0.12
105 0.1
106 0.12
107 0.11
108 0.11
109 0.1
110 0.1
111 0.11
112 0.11
113 0.11
114 0.12
115 0.11
116 0.13
117 0.13
118 0.15
119 0.17
120 0.16
121 0.17
122 0.16
123 0.16
124 0.13
125 0.13
126 0.11
127 0.07
128 0.07
129 0.05
130 0.03
131 0.03
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.04
141 0.04
142 0.06
143 0.07
144 0.09
145 0.16
146 0.21
147 0.22
148 0.23
149 0.24
150 0.24
151 0.25
152 0.25
153 0.2
154 0.15
155 0.15
156 0.13
157 0.12
158 0.1
159 0.08
160 0.06
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.05
181 0.05
182 0.05
183 0.07
184 0.08
185 0.08
186 0.11
187 0.14
188 0.13
189 0.15
190 0.24
191 0.22
192 0.23
193 0.25
194 0.23
195 0.21
196 0.21
197 0.2
198 0.13
199 0.15
200 0.14
201 0.13
202 0.13
203 0.16
204 0.16
205 0.18
206 0.17
207 0.15
208 0.18
209 0.21
210 0.21
211 0.19
212 0.25
213 0.22
214 0.22
215 0.25
216 0.25
217 0.24
218 0.28
219 0.34
220 0.36
221 0.44
222 0.54
223 0.62
224 0.7
225 0.79
226 0.85
227 0.88
228 0.92
229 0.95
230 0.96
231 0.96
232 0.97
233 0.96
234 0.97
235 0.96
236 0.96
237 0.95