Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FR61

Protein Details
Accession Q6FR61   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
163-182PFWNPKTKKIWGFRKIPNTYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 8.5, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036286  LexA/Signal_pep-like_sf  
IPR000223  Pept_S26A_signal_pept_1  
IPR019757  Pept_S26A_signal_pept_1_Lys-AS  
IPR019756  Pept_S26A_signal_pept_1_Ser-AS  
IPR019533  Peptidase_S26  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006627  P:protein processing involved in protein targeting to mitochondrion  
GO:0006465  P:signal peptide processing  
KEGG cgr:CAGL0I00682g  -  
Pfam View protein in Pfam  
PF10502  Peptidase_S26  
PROSITE View protein in PROSITE  
PS00501  SPASE_I_1  
PS00760  SPASE_I_2  
CDD cd06530  S26_SPase_I  
Amino Acid Sequences MLRIIRPGTYVIQSLCFLHVFHTYFYEFTETRGESMLPTLSATKDFVHVDKRYRNGKNVRLGDCIVAVKPTDPTHRVCKRISGMPGDLILVDPGVKKDLVNYSRSEEAMDDNEEFRTYIRVPKGHVWVTGDNLSHSLDSRTYNALPMGLIKGKIVAANDFNEPFWNPKTKKIWGFRKIPNTYEDFLSVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.16
5 0.15
6 0.2
7 0.18
8 0.18
9 0.2
10 0.19
11 0.19
12 0.2
13 0.23
14 0.18
15 0.18
16 0.23
17 0.2
18 0.2
19 0.21
20 0.2
21 0.15
22 0.16
23 0.16
24 0.1
25 0.1
26 0.11
27 0.11
28 0.12
29 0.13
30 0.11
31 0.13
32 0.15
33 0.16
34 0.22
35 0.24
36 0.3
37 0.34
38 0.4
39 0.46
40 0.49
41 0.55
42 0.57
43 0.61
44 0.64
45 0.65
46 0.62
47 0.56
48 0.53
49 0.45
50 0.38
51 0.31
52 0.22
53 0.15
54 0.12
55 0.09
56 0.11
57 0.12
58 0.15
59 0.17
60 0.2
61 0.29
62 0.35
63 0.38
64 0.37
65 0.4
66 0.39
67 0.42
68 0.42
69 0.35
70 0.31
71 0.27
72 0.27
73 0.21
74 0.18
75 0.12
76 0.09
77 0.05
78 0.05
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.07
85 0.14
86 0.16
87 0.17
88 0.19
89 0.2
90 0.22
91 0.22
92 0.21
93 0.14
94 0.14
95 0.13
96 0.13
97 0.11
98 0.11
99 0.11
100 0.1
101 0.1
102 0.09
103 0.1
104 0.09
105 0.14
106 0.17
107 0.18
108 0.21
109 0.27
110 0.32
111 0.32
112 0.32
113 0.31
114 0.28
115 0.3
116 0.3
117 0.25
118 0.2
119 0.19
120 0.18
121 0.14
122 0.14
123 0.12
124 0.1
125 0.12
126 0.13
127 0.16
128 0.15
129 0.16
130 0.16
131 0.15
132 0.13
133 0.13
134 0.14
135 0.13
136 0.13
137 0.12
138 0.12
139 0.13
140 0.14
141 0.14
142 0.13
143 0.14
144 0.16
145 0.19
146 0.18
147 0.18
148 0.19
149 0.19
150 0.2
151 0.22
152 0.3
153 0.28
154 0.36
155 0.43
156 0.5
157 0.58
158 0.64
159 0.71
160 0.7
161 0.78
162 0.78
163 0.82
164 0.79
165 0.72
166 0.67
167 0.62
168 0.56
169 0.49