Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FNS4

Protein Details
Accession Q6FNS4   
Localization Confidence High
Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
211-242LRTKYYKKLDQERGKKGRKNNSKVKGNHKRFDBasic
265-297SQLDRKYSGSTKKKNTNKKQKKNNNSHRDPLEFHydrophilic
315-344SRNDDKAKAKNMRWNNSKKNRKSYRSTERNHydrophilic
NLS Segment(s)
PositionSequence
222-239ERGKKGRKNNSKVKGNHK
276-288KKKNTNKKQKKNN
320-336KAKAKNMRWNNSKKNRK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016713  Air1/2_Saccharomycetales  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0031499  C:TRAMP complex  
GO:0003676  F:nucleic acid binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0043629  P:ncRNA polyadenylation  
GO:0071031  P:nuclear mRNA surveillance of mRNA 3'-end processing  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071036  P:nuclear polyadenylation-dependent snoRNA catabolic process  
GO:0071037  P:nuclear polyadenylation-dependent snRNA catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
KEGG cgr:CAGL0J09460g  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MTSLSEVETMDTLPFVKDTTPMSNDDIKVVAPSIEQVGNDPNELRFLRGEGRYFGLDDSEGIKEPEPKCRNCSQRGHFKRDCPHVICTFCGSMDDHYSQHCPKAIKCANCNKVGHYRSQCPNKWKRVFCTLCNSKLHDRDRCPSLWRSYLLREELTGKGNKKKLDLDTDAIYCYNCGGNGHFGDDCNQRRSSRVPKDDGSAFAGNNLRDELRTKYYKKLDQERGKKGRKNNSKVKGNHKRFDDNNNFNYDDYEYDDSIYDEWDNSQLDRKYSGSTKKKNTNKKQKKNNNSHRDPLEFPRSKRNDFNDNSKRGNFSRNDDKAKAKNMRWNNSKKNRKSYRSTERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.11
5 0.15
6 0.2
7 0.22
8 0.25
9 0.29
10 0.35
11 0.34
12 0.33
13 0.3
14 0.24
15 0.23
16 0.2
17 0.16
18 0.1
19 0.1
20 0.12
21 0.13
22 0.13
23 0.13
24 0.18
25 0.18
26 0.2
27 0.19
28 0.17
29 0.21
30 0.21
31 0.21
32 0.17
33 0.18
34 0.23
35 0.26
36 0.28
37 0.24
38 0.27
39 0.26
40 0.26
41 0.24
42 0.19
43 0.15
44 0.14
45 0.14
46 0.13
47 0.13
48 0.13
49 0.14
50 0.2
51 0.21
52 0.31
53 0.35
54 0.37
55 0.43
56 0.5
57 0.57
58 0.59
59 0.68
60 0.66
61 0.7
62 0.76
63 0.8
64 0.76
65 0.75
66 0.75
67 0.74
68 0.74
69 0.66
70 0.63
71 0.59
72 0.56
73 0.49
74 0.44
75 0.35
76 0.27
77 0.25
78 0.2
79 0.16
80 0.18
81 0.18
82 0.16
83 0.17
84 0.22
85 0.21
86 0.22
87 0.24
88 0.22
89 0.21
90 0.32
91 0.36
92 0.38
93 0.45
94 0.53
95 0.54
96 0.59
97 0.59
98 0.53
99 0.56
100 0.52
101 0.52
102 0.48
103 0.5
104 0.52
105 0.6
106 0.61
107 0.62
108 0.69
109 0.72
110 0.75
111 0.71
112 0.68
113 0.69
114 0.68
115 0.62
116 0.63
117 0.59
118 0.56
119 0.54
120 0.54
121 0.49
122 0.53
123 0.56
124 0.52
125 0.5
126 0.49
127 0.5
128 0.47
129 0.46
130 0.42
131 0.4
132 0.36
133 0.34
134 0.32
135 0.31
136 0.34
137 0.31
138 0.27
139 0.23
140 0.23
141 0.22
142 0.23
143 0.23
144 0.22
145 0.27
146 0.3
147 0.31
148 0.3
149 0.33
150 0.32
151 0.35
152 0.35
153 0.31
154 0.29
155 0.29
156 0.27
157 0.22
158 0.19
159 0.12
160 0.1
161 0.07
162 0.05
163 0.05
164 0.05
165 0.08
166 0.08
167 0.1
168 0.09
169 0.09
170 0.13
171 0.19
172 0.21
173 0.22
174 0.24
175 0.23
176 0.25
177 0.31
178 0.37
179 0.4
180 0.44
181 0.45
182 0.44
183 0.48
184 0.48
185 0.43
186 0.38
187 0.3
188 0.23
189 0.22
190 0.23
191 0.19
192 0.18
193 0.17
194 0.12
195 0.11
196 0.14
197 0.15
198 0.18
199 0.24
200 0.26
201 0.33
202 0.4
203 0.45
204 0.51
205 0.57
206 0.62
207 0.66
208 0.73
209 0.76
210 0.79
211 0.82
212 0.8
213 0.78
214 0.78
215 0.79
216 0.79
217 0.79
218 0.79
219 0.8
220 0.81
221 0.84
222 0.85
223 0.83
224 0.79
225 0.74
226 0.72
227 0.66
228 0.7
229 0.69
230 0.66
231 0.6
232 0.59
233 0.54
234 0.46
235 0.44
236 0.34
237 0.25
238 0.22
239 0.21
240 0.16
241 0.16
242 0.16
243 0.15
244 0.14
245 0.14
246 0.1
247 0.07
248 0.08
249 0.1
250 0.1
251 0.1
252 0.17
253 0.18
254 0.19
255 0.21
256 0.22
257 0.24
258 0.3
259 0.4
260 0.43
261 0.51
262 0.59
263 0.67
264 0.75
265 0.82
266 0.87
267 0.88
268 0.89
269 0.91
270 0.93
271 0.94
272 0.95
273 0.96
274 0.96
275 0.95
276 0.91
277 0.89
278 0.84
279 0.78
280 0.71
281 0.68
282 0.68
283 0.63
284 0.58
285 0.61
286 0.61
287 0.61
288 0.65
289 0.63
290 0.62
291 0.61
292 0.69
293 0.69
294 0.69
295 0.7
296 0.64
297 0.63
298 0.55
299 0.59
300 0.53
301 0.5
302 0.55
303 0.57
304 0.63
305 0.61
306 0.67
307 0.65
308 0.71
309 0.72
310 0.67
311 0.68
312 0.7
313 0.76
314 0.78
315 0.82
316 0.83
317 0.85
318 0.9
319 0.9
320 0.91
321 0.91
322 0.9
323 0.89
324 0.89