Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B4UMX8

Protein Details
Accession B4UMX8    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-91TLPPYSCYKKNQLKWVQPKVMEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 7, E.R. 7, nucl 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0045047  P:protein targeting to ER  
GO:0006465  P:signal peptide processing  
KEGG cgr:CAGL0B03855g  -  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MDGVNEILNEVRKHLVLPVDFKAQERIEKLAYVILGIGAVTSFGIGFVTQSLQNLLVCFGGFFVVTLIVTLPPYSCYKKNQLKWVQPKVMEIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.19
4 0.23
5 0.25
6 0.29
7 0.29
8 0.3
9 0.33
10 0.29
11 0.3
12 0.28
13 0.28
14 0.23
15 0.22
16 0.22
17 0.17
18 0.16
19 0.12
20 0.1
21 0.06
22 0.05
23 0.05
24 0.04
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.07
60 0.12
61 0.17
62 0.2
63 0.25
64 0.36
65 0.46
66 0.52
67 0.61
68 0.67
69 0.73
70 0.8
71 0.85
72 0.83
73 0.74
74 0.74