Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6FUC9

Protein Details
Accession A0A0K6FUC9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-70DSPNDEPKNKPKSKSSRKSTNHydrophilic
NLS Segment(s)
PositionSequence
59-66KPKSKSSR
Subcellular Location(s) nucl 13, cyto_nucl 11.5, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MPADRLESPFGGTSGYIPGLADYGPDLPNAKQARIKTTVGTATTVSLFADSPNDEPKNKPKSKSSRKSTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.05
10 0.07
11 0.07
12 0.08
13 0.09
14 0.09
15 0.16
16 0.17
17 0.18
18 0.2
19 0.2
20 0.25
21 0.28
22 0.28
23 0.21
24 0.23
25 0.24
26 0.21
27 0.21
28 0.16
29 0.13
30 0.12
31 0.12
32 0.09
33 0.08
34 0.07
35 0.06
36 0.08
37 0.08
38 0.1
39 0.17
40 0.19
41 0.2
42 0.25
43 0.34
44 0.43
45 0.48
46 0.51
47 0.55
48 0.64
49 0.74
50 0.8