Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G9G5

Protein Details
Accession A0A0K6G9G5   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MVLPRARKPRQISSIRRNCMFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012334  Pectin_lyas_fold  
IPR011050  Pectin_lyase_fold/virulence  
Amino Acid Sequences MVLPRARKPRQISSIRRNCMFETQSQYPTLSIILRFPTQVHLPEIPPSGLEQKDAAPEASFVDSNDGINTRLGAQLLVENNVWEGVKKPLYATDRGFAVARGNDFGGASNSAPAGTFSKAPYDYTLLEAGKVKSSVSSAGATLSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.79
4 0.72
5 0.64
6 0.62
7 0.54
8 0.48
9 0.46
10 0.44
11 0.43
12 0.41
13 0.39
14 0.31
15 0.29
16 0.25
17 0.18
18 0.13
19 0.13
20 0.15
21 0.15
22 0.15
23 0.15
24 0.17
25 0.18
26 0.19
27 0.21
28 0.2
29 0.2
30 0.22
31 0.23
32 0.2
33 0.18
34 0.17
35 0.18
36 0.16
37 0.16
38 0.14
39 0.13
40 0.15
41 0.15
42 0.14
43 0.09
44 0.1
45 0.1
46 0.1
47 0.09
48 0.08
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.08
57 0.06
58 0.07
59 0.07
60 0.06
61 0.05
62 0.07
63 0.08
64 0.09
65 0.08
66 0.07
67 0.07
68 0.08
69 0.08
70 0.06
71 0.07
72 0.09
73 0.1
74 0.1
75 0.11
76 0.16
77 0.19
78 0.23
79 0.23
80 0.22
81 0.21
82 0.22
83 0.22
84 0.17
85 0.17
86 0.14
87 0.13
88 0.13
89 0.12
90 0.11
91 0.11
92 0.12
93 0.1
94 0.1
95 0.09
96 0.09
97 0.09
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.11
104 0.11
105 0.17
106 0.17
107 0.19
108 0.2
109 0.21
110 0.2
111 0.21
112 0.25
113 0.2
114 0.21
115 0.24
116 0.22
117 0.22
118 0.22
119 0.19
120 0.16
121 0.17
122 0.18
123 0.16
124 0.16
125 0.13