Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6FY77

Protein Details
Accession A0A0K6FY77    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27YLRSRRAPTRSIRNHPNVRTRSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MADKGYLRSRRAPTRSIRNHPNVRTRSSVCDLTRSSNRAYTNTPCVRGAQADIIGAYTATCPAESPTGRPAAEPVRPYLRVRTILV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.74
4 0.76
5 0.76
6 0.8
7 0.8
8 0.81
9 0.74
10 0.68
11 0.66
12 0.58
13 0.55
14 0.5
15 0.5
16 0.4
17 0.42
18 0.38
19 0.38
20 0.4
21 0.36
22 0.33
23 0.3
24 0.31
25 0.28
26 0.3
27 0.27
28 0.32
29 0.32
30 0.33
31 0.29
32 0.28
33 0.27
34 0.24
35 0.21
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.08
42 0.07
43 0.06
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.06
50 0.12
51 0.13
52 0.15
53 0.19
54 0.23
55 0.23
56 0.23
57 0.26
58 0.26
59 0.31
60 0.3
61 0.31
62 0.34
63 0.37
64 0.39
65 0.43
66 0.44