Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6GBB9

Protein Details
Accession A0A0K6GBB9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-30EGCGKKKSKICCIYHKPKRFDBasic
NLS Segment(s)
PositionSequence
73-82KGGSKGKRKA
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MWDADVIDNEGCGKKKSKICCIYHKPKRFDESSSESSGDESDTSCGSNDSRKHAHKRPDNGGDANPGPNAYEKGGSKGKRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.39
4 0.48
5 0.54
6 0.59
7 0.68
8 0.74
9 0.78
10 0.82
11 0.84
12 0.8
13 0.76
14 0.75
15 0.67
16 0.59
17 0.55
18 0.53
19 0.47
20 0.44
21 0.39
22 0.33
23 0.31
24 0.27
25 0.2
26 0.12
27 0.08
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.12
35 0.13
36 0.19
37 0.25
38 0.32
39 0.4
40 0.47
41 0.57
42 0.6
43 0.66
44 0.69
45 0.7
46 0.68
47 0.63
48 0.57
49 0.52
50 0.46
51 0.39
52 0.3
53 0.23
54 0.19
55 0.18
56 0.18
57 0.15
58 0.18
59 0.17
60 0.24
61 0.32
62 0.37