Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G5H2

Protein Details
Accession A0A0K6G5H2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MTIKIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-53KKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKKTR
Subcellular Location(s) nucl 16.5, mito_nucl 12, mito 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTIKIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKKTRHLLPNGLKKFVVNNVRELELLLMHNKSFAAEIAHGVSSKNRVTILERAKALSIKVTNPAAKLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.91
4 0.91
5 0.88
6 0.86
7 0.83
8 0.76
9 0.66
10 0.63
11 0.61
12 0.59
13 0.61
14 0.61
15 0.59
16 0.57
17 0.58
18 0.61
19 0.63
20 0.64
21 0.64
22 0.65
23 0.71
24 0.78
25 0.82
26 0.76
27 0.73
28 0.7
29 0.67
30 0.67
31 0.64
32 0.64
33 0.65
34 0.71
35 0.68
36 0.65
37 0.62
38 0.54
39 0.53
40 0.48
41 0.46
42 0.48
43 0.51
44 0.57
45 0.56
46 0.54
47 0.47
48 0.41
49 0.37
50 0.34
51 0.33
52 0.23
53 0.25
54 0.25
55 0.26
56 0.26
57 0.25
58 0.19
59 0.12
60 0.12
61 0.1
62 0.09
63 0.08
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.1
73 0.1
74 0.1
75 0.1
76 0.12
77 0.14
78 0.14
79 0.14
80 0.13
81 0.14
82 0.18
83 0.27
84 0.32
85 0.34
86 0.34
87 0.34
88 0.36
89 0.36
90 0.32
91 0.3
92 0.26
93 0.22
94 0.27
95 0.31
96 0.32
97 0.33
98 0.38
99 0.34