Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6G961

Protein Details
Accession A0A0K6G961    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
167-191ITLLVSLARRRHKRKHGLSGVVSRAHydrophilic
NLS Segment(s)
PositionSequence
175-181RRRHKRK
Subcellular Location(s) cyto 12.5, nucl 10, cyto_pero 7.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSAGPSFLTVHELPNGDIGLTLSNQSGDVYVLRGSAKPGPKGSRHTQDIVRCKDDTVLASVAWINPKKDLIRIEKAAYPHGVEDCGYWMRLEDAWKSAAPTKGDCTEVFTGSDHRLYEWRLEMRNLRKLYAPDRIEPIALETQFTPRGHIVEMNSVDCVGVGEMMYITLLVSLARRRHKRKHGLSGVVSRAVENVLFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.14
4 0.14
5 0.12
6 0.1
7 0.1
8 0.1
9 0.08
10 0.08
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.1
20 0.1
21 0.12
22 0.18
23 0.23
24 0.26
25 0.32
26 0.36
27 0.41
28 0.48
29 0.53
30 0.56
31 0.55
32 0.56
33 0.56
34 0.59
35 0.63
36 0.62
37 0.57
38 0.48
39 0.44
40 0.41
41 0.36
42 0.29
43 0.23
44 0.18
45 0.14
46 0.14
47 0.14
48 0.13
49 0.17
50 0.18
51 0.15
52 0.15
53 0.18
54 0.18
55 0.21
56 0.26
57 0.28
58 0.32
59 0.34
60 0.35
61 0.35
62 0.36
63 0.34
64 0.29
65 0.22
66 0.17
67 0.15
68 0.13
69 0.1
70 0.09
71 0.1
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.09
78 0.1
79 0.09
80 0.09
81 0.11
82 0.11
83 0.12
84 0.14
85 0.16
86 0.16
87 0.16
88 0.17
89 0.17
90 0.19
91 0.18
92 0.19
93 0.18
94 0.17
95 0.17
96 0.15
97 0.15
98 0.15
99 0.16
100 0.11
101 0.11
102 0.12
103 0.12
104 0.14
105 0.16
106 0.18
107 0.18
108 0.21
109 0.27
110 0.31
111 0.38
112 0.37
113 0.34
114 0.34
115 0.36
116 0.38
117 0.4
118 0.37
119 0.31
120 0.34
121 0.34
122 0.3
123 0.27
124 0.26
125 0.21
126 0.19
127 0.17
128 0.14
129 0.16
130 0.21
131 0.21
132 0.21
133 0.17
134 0.18
135 0.18
136 0.2
137 0.19
138 0.21
139 0.23
140 0.21
141 0.2
142 0.19
143 0.18
144 0.15
145 0.14
146 0.07
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.06
159 0.12
160 0.19
161 0.29
162 0.39
163 0.47
164 0.58
165 0.68
166 0.77
167 0.82
168 0.87
169 0.87
170 0.86
171 0.85
172 0.84
173 0.77
174 0.71
175 0.6
176 0.49
177 0.4
178 0.32