Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G149

Protein Details
Accession A0A0K6G149    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
214-238SGAAEGEKKKRKKSRKETYSSYIYKHydrophilic
NLS Segment(s)
PositionSequence
195-238EKKPASTAGKAPAKAPDSAKKPAAKATASGAAEGEKKKRKKSRK
Subcellular Location(s) cyto 15.5, cyto_nucl 13, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
IPR037588  MLST8  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0031931  C:TORC1 complex  
GO:0031932  C:TORC2 complex  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0031929  P:TOR signaling  
Pfam View protein in Pfam  
PF00125  Histone  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MSQSNSYSPEVVLVTGSYDHEIRFWEAWSGLCSRTIQRSGESGQVNRLSISPDKRLLAAAIYTKVHIYDIAGNSSTPRAVFEGHKGNVTSVSFHSEGKWVVTGSEDGTIRIWDLRTSNLHRVYENEVPINDVCIHPNQGELISCDQAGRIRQWDLTLQEEACTVELVEYVSRLXXXXXXXXXFRITMPPKSTAAEKKPASTAGKAPAKAPDSAKKPAAKATASGAAEGEKKKRKKSRKETYSSYIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIAEEASRLASYSKKSTISSREIQTSVRLILPGELSKHAISEGTKSVTKFSAGAGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.11
5 0.12
6 0.12
7 0.12
8 0.14
9 0.17
10 0.17
11 0.17
12 0.17
13 0.17
14 0.18
15 0.2
16 0.2
17 0.17
18 0.19
19 0.2
20 0.21
21 0.27
22 0.31
23 0.3
24 0.29
25 0.33
26 0.33
27 0.38
28 0.39
29 0.33
30 0.35
31 0.36
32 0.34
33 0.31
34 0.29
35 0.26
36 0.27
37 0.31
38 0.3
39 0.31
40 0.31
41 0.31
42 0.31
43 0.28
44 0.23
45 0.21
46 0.19
47 0.18
48 0.18
49 0.18
50 0.17
51 0.17
52 0.15
53 0.13
54 0.11
55 0.15
56 0.16
57 0.18
58 0.18
59 0.18
60 0.18
61 0.19
62 0.18
63 0.11
64 0.11
65 0.09
66 0.11
67 0.13
68 0.18
69 0.26
70 0.26
71 0.29
72 0.28
73 0.27
74 0.28
75 0.26
76 0.22
77 0.15
78 0.19
79 0.17
80 0.17
81 0.18
82 0.17
83 0.17
84 0.16
85 0.16
86 0.11
87 0.1
88 0.11
89 0.11
90 0.09
91 0.12
92 0.11
93 0.11
94 0.11
95 0.11
96 0.1
97 0.11
98 0.11
99 0.08
100 0.09
101 0.12
102 0.17
103 0.22
104 0.29
105 0.32
106 0.33
107 0.31
108 0.33
109 0.36
110 0.35
111 0.32
112 0.26
113 0.21
114 0.22
115 0.22
116 0.21
117 0.16
118 0.12
119 0.11
120 0.11
121 0.13
122 0.11
123 0.11
124 0.09
125 0.09
126 0.09
127 0.1
128 0.11
129 0.09
130 0.1
131 0.09
132 0.09
133 0.1
134 0.11
135 0.11
136 0.11
137 0.11
138 0.12
139 0.13
140 0.15
141 0.15
142 0.16
143 0.16
144 0.14
145 0.13
146 0.13
147 0.12
148 0.1
149 0.08
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.14
163 0.19
164 0.24
165 0.27
166 0.29
167 0.3
168 0.3
169 0.34
170 0.33
171 0.32
172 0.35
173 0.33
174 0.33
175 0.33
176 0.37
177 0.35
178 0.3
179 0.29
180 0.29
181 0.33
182 0.31
183 0.31
184 0.32
185 0.31
186 0.32
187 0.32
188 0.31
189 0.31
190 0.35
191 0.39
192 0.37
193 0.36
194 0.38
195 0.39
196 0.32
197 0.28
198 0.27
199 0.29
200 0.26
201 0.25
202 0.2
203 0.17
204 0.21
205 0.22
206 0.26
207 0.28
208 0.33
209 0.43
210 0.53
211 0.62
212 0.69
213 0.78
214 0.82
215 0.85
216 0.88
217 0.86
218 0.84
219 0.83
220 0.74
221 0.66
222 0.62
223 0.52
224 0.46
225 0.44
226 0.43
227 0.37
228 0.4
229 0.41
230 0.39
231 0.4
232 0.38
233 0.35
234 0.33
235 0.32
236 0.26
237 0.23
238 0.18
239 0.18
240 0.18
241 0.16
242 0.13
243 0.13
244 0.13
245 0.13
246 0.13
247 0.1
248 0.11
249 0.12
250 0.1
251 0.09
252 0.08
253 0.09
254 0.09
255 0.1
256 0.09
257 0.09
258 0.09
259 0.1
260 0.1
261 0.09
262 0.1
263 0.13
264 0.16
265 0.21
266 0.24
267 0.26
268 0.28
269 0.35
270 0.41
271 0.45
272 0.48
273 0.48
274 0.49
275 0.48
276 0.47
277 0.44
278 0.39
279 0.34
280 0.28
281 0.24
282 0.19
283 0.19
284 0.21
285 0.2
286 0.2
287 0.2
288 0.21
289 0.21
290 0.21
291 0.19
292 0.18
293 0.17
294 0.19
295 0.21
296 0.23
297 0.26
298 0.26
299 0.29
300 0.28
301 0.28
302 0.24
303 0.2