Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P48561

Protein Details
Accession P48561   
Localization Confidence High
Confidence Score 21.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MTRLKAKYSPTKGKRKEDKHTKRMRKSSFTRTQKMLHydrophilic
528-555IYKLDEPAKKKQKAKKDKREGEIKKSAIBasic
559-583PPDFGVSRSKLKRKVKKTDQGSLLHHydrophilic
NLS Segment(s)
PositionSequence
7-26KYSPTKGKRKEDKHTKRMRK
535-575AKKKQKAKKDKREGEIKKSAIPSPPPDFGVSRSKLKRKVKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR002058  PAP_assoc  
IPR002934  Polymerase_NTP_transf_dom  
IPR045862  Trf4-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0031499  C:TRAMP complex  
GO:0046872  F:metal ion binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0071044  P:histone mRNA catabolic process  
GO:0043629  P:ncRNA polyadenylation  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071042  P:nuclear polyadenylation-dependent mRNA catabolic process  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071036  P:nuclear polyadenylation-dependent snoRNA catabolic process  
GO:0071037  P:nuclear polyadenylation-dependent snRNA catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
GO:0071051  P:polyadenylation-dependent snoRNA 3'-end processing  
GO:0031123  P:RNA 3'-end processing  
GO:0000292  P:RNA fragment catabolic process  
GO:0043631  P:RNA polyadenylation  
GO:0071050  P:sno(s)RNA polyadenylation  
GO:0034475  P:U4 snRNA 3'-end processing  
KEGG sce:YNL299W  -  
Pfam View protein in Pfam  
PF01909  NTP_transf_2  
PF03828  PAP_assoc  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MTRLKAKYSPTKGKRKEDKHTKRMRKSSFTRTQKMLEVFNDNRSHFNKYESLAIDVEDDDTFGNLVLMENDKSDVDIPVIEEVTSSEDEQRAESSKRNNSLEDNQDFIAFSDSSEDETEQIKEDDDERSSFLLTDEHEVSKLTSQQSLNTESACNVEYPWIRNHCHSKQRRIADWLTSEIKDFVHYISPSKNEIKCRNRTIDKLRRAVKELWSDADLHVFGSFATDLYLPGSDIDCVVNSRNRDKEDRNYIYELARHLKNKGLAIRMEVIVKTRVPIIKFIEPQSQLHIDVSFERTNGLEAAKLIREWLRDSPGLRELVLIIKQFLHSRRLNNVHTGGLGGFTVICLVYSFLNMHPRIKSNDIDVLDNLGVLLIDFFELYGKNFGYDDVAISISDGYASYIPKSCWRTLEPSRSKFSLAIQDPGDPNNNISRGSFNMKDIKKAFAGAFELLVNKCWELNSATFKDRVGKSILGNVIKYRGQKRDFNDERDLVQNKAIIENERYHKRRTRIVQEDLFINDTEDLPVEEIYKLDEPAKKKQKAKKDKREGEIKKSAIPSPPPDFGVSRSKLKRKVKKTDQGSLLHQNNLSIDDLMGLSENDQESDQDQKGRDTPSGQDEKSPLETKTVDAQTRRDYWLSKGQAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.9
4 0.91
5 0.92
6 0.92
7 0.94
8 0.94
9 0.94
10 0.95
11 0.92
12 0.91
13 0.89
14 0.89
15 0.88
16 0.87
17 0.84
18 0.79
19 0.74
20 0.71
21 0.66
22 0.6
23 0.53
24 0.52
25 0.47
26 0.5
27 0.52
28 0.45
29 0.48
30 0.46
31 0.49
32 0.41
33 0.43
34 0.39
35 0.35
36 0.41
37 0.36
38 0.36
39 0.3
40 0.29
41 0.26
42 0.21
43 0.21
44 0.13
45 0.12
46 0.09
47 0.09
48 0.08
49 0.07
50 0.07
51 0.05
52 0.06
53 0.07
54 0.09
55 0.09
56 0.1
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.1
63 0.1
64 0.1
65 0.11
66 0.12
67 0.1
68 0.09
69 0.09
70 0.12
71 0.13
72 0.13
73 0.13
74 0.15
75 0.15
76 0.16
77 0.18
78 0.19
79 0.2
80 0.25
81 0.31
82 0.37
83 0.44
84 0.46
85 0.46
86 0.48
87 0.54
88 0.57
89 0.51
90 0.46
91 0.39
92 0.37
93 0.34
94 0.29
95 0.24
96 0.15
97 0.12
98 0.13
99 0.13
100 0.14
101 0.15
102 0.15
103 0.13
104 0.14
105 0.15
106 0.14
107 0.14
108 0.12
109 0.12
110 0.14
111 0.15
112 0.16
113 0.16
114 0.16
115 0.16
116 0.16
117 0.15
118 0.14
119 0.13
120 0.12
121 0.15
122 0.16
123 0.16
124 0.16
125 0.16
126 0.16
127 0.17
128 0.2
129 0.17
130 0.2
131 0.2
132 0.24
133 0.27
134 0.31
135 0.29
136 0.26
137 0.25
138 0.2
139 0.21
140 0.18
141 0.14
142 0.1
143 0.15
144 0.16
145 0.19
146 0.25
147 0.29
148 0.3
149 0.36
150 0.45
151 0.47
152 0.55
153 0.61
154 0.65
155 0.68
156 0.73
157 0.72
158 0.7
159 0.65
160 0.6
161 0.54
162 0.49
163 0.44
164 0.37
165 0.33
166 0.27
167 0.24
168 0.19
169 0.17
170 0.13
171 0.14
172 0.15
173 0.16
174 0.19
175 0.21
176 0.24
177 0.31
178 0.34
179 0.37
180 0.46
181 0.53
182 0.58
183 0.62
184 0.67
185 0.65
186 0.69
187 0.72
188 0.72
189 0.72
190 0.71
191 0.72
192 0.66
193 0.66
194 0.62
195 0.58
196 0.55
197 0.49
198 0.42
199 0.36
200 0.34
201 0.29
202 0.27
203 0.2
204 0.12
205 0.1
206 0.08
207 0.07
208 0.07
209 0.07
210 0.05
211 0.06
212 0.06
213 0.06
214 0.07
215 0.07
216 0.06
217 0.06
218 0.07
219 0.06
220 0.06
221 0.06
222 0.06
223 0.07
224 0.09
225 0.12
226 0.14
227 0.19
228 0.22
229 0.26
230 0.31
231 0.35
232 0.41
233 0.49
234 0.51
235 0.5
236 0.48
237 0.46
238 0.42
239 0.39
240 0.33
241 0.28
242 0.26
243 0.24
244 0.23
245 0.25
246 0.26
247 0.28
248 0.28
249 0.27
250 0.24
251 0.25
252 0.26
253 0.23
254 0.21
255 0.18
256 0.16
257 0.14
258 0.14
259 0.12
260 0.13
261 0.14
262 0.14
263 0.18
264 0.2
265 0.24
266 0.27
267 0.29
268 0.32
269 0.31
270 0.31
271 0.31
272 0.28
273 0.23
274 0.21
275 0.19
276 0.13
277 0.12
278 0.16
279 0.13
280 0.11
281 0.11
282 0.11
283 0.11
284 0.11
285 0.1
286 0.06
287 0.06
288 0.08
289 0.08
290 0.07
291 0.08
292 0.09
293 0.1
294 0.11
295 0.13
296 0.15
297 0.16
298 0.17
299 0.19
300 0.2
301 0.2
302 0.18
303 0.16
304 0.13
305 0.13
306 0.14
307 0.12
308 0.09
309 0.09
310 0.1
311 0.12
312 0.14
313 0.18
314 0.19
315 0.22
316 0.28
317 0.34
318 0.34
319 0.36
320 0.35
321 0.29
322 0.26
323 0.24
324 0.17
325 0.11
326 0.1
327 0.06
328 0.04
329 0.03
330 0.04
331 0.03
332 0.03
333 0.03
334 0.03
335 0.04
336 0.04
337 0.05
338 0.07
339 0.13
340 0.14
341 0.16
342 0.17
343 0.2
344 0.23
345 0.25
346 0.24
347 0.2
348 0.25
349 0.24
350 0.24
351 0.21
352 0.2
353 0.16
354 0.15
355 0.13
356 0.07
357 0.06
358 0.04
359 0.04
360 0.02
361 0.02
362 0.02
363 0.02
364 0.03
365 0.03
366 0.04
367 0.06
368 0.06
369 0.07
370 0.07
371 0.07
372 0.08
373 0.08
374 0.08
375 0.07
376 0.07
377 0.07
378 0.07
379 0.07
380 0.05
381 0.05
382 0.04
383 0.04
384 0.05
385 0.06
386 0.07
387 0.09
388 0.1
389 0.16
390 0.21
391 0.22
392 0.24
393 0.26
394 0.33
395 0.39
396 0.49
397 0.52
398 0.53
399 0.56
400 0.53
401 0.52
402 0.45
403 0.4
404 0.38
405 0.31
406 0.3
407 0.26
408 0.29
409 0.28
410 0.29
411 0.29
412 0.19
413 0.19
414 0.19
415 0.19
416 0.17
417 0.16
418 0.17
419 0.17
420 0.22
421 0.22
422 0.21
423 0.29
424 0.29
425 0.35
426 0.35
427 0.35
428 0.3
429 0.31
430 0.28
431 0.21
432 0.23
433 0.16
434 0.16
435 0.13
436 0.15
437 0.13
438 0.14
439 0.13
440 0.1
441 0.1
442 0.1
443 0.11
444 0.11
445 0.14
446 0.2
447 0.23
448 0.25
449 0.25
450 0.26
451 0.32
452 0.3
453 0.29
454 0.26
455 0.25
456 0.24
457 0.29
458 0.34
459 0.28
460 0.28
461 0.27
462 0.26
463 0.27
464 0.32
465 0.32
466 0.35
467 0.39
468 0.44
469 0.48
470 0.56
471 0.59
472 0.6
473 0.61
474 0.54
475 0.51
476 0.52
477 0.49
478 0.39
479 0.35
480 0.3
481 0.24
482 0.24
483 0.24
484 0.19
485 0.2
486 0.26
487 0.31
488 0.39
489 0.42
490 0.46
491 0.52
492 0.54
493 0.61
494 0.63
495 0.67
496 0.65
497 0.71
498 0.69
499 0.64
500 0.61
501 0.54
502 0.47
503 0.36
504 0.28
505 0.2
506 0.15
507 0.13
508 0.11
509 0.09
510 0.08
511 0.09
512 0.09
513 0.08
514 0.08
515 0.11
516 0.12
517 0.12
518 0.16
519 0.21
520 0.24
521 0.35
522 0.45
523 0.5
524 0.58
525 0.65
526 0.72
527 0.79
528 0.86
529 0.86
530 0.87
531 0.89
532 0.89
533 0.92
534 0.88
535 0.87
536 0.85
537 0.76
538 0.7
539 0.64
540 0.59
541 0.54
542 0.52
543 0.49
544 0.45
545 0.46
546 0.41
547 0.41
548 0.38
549 0.36
550 0.4
551 0.38
552 0.42
553 0.48
554 0.54
555 0.61
556 0.71
557 0.77
558 0.78
559 0.85
560 0.86
561 0.88
562 0.87
563 0.88
564 0.85
565 0.79
566 0.76
567 0.75
568 0.68
569 0.62
570 0.53
571 0.45
572 0.38
573 0.34
574 0.28
575 0.19
576 0.15
577 0.12
578 0.11
579 0.1
580 0.1
581 0.08
582 0.07
583 0.1
584 0.1
585 0.1
586 0.11
587 0.11
588 0.12
589 0.18
590 0.2
591 0.22
592 0.23
593 0.26
594 0.31
595 0.33
596 0.34
597 0.31
598 0.34
599 0.38
600 0.45
601 0.42
602 0.43
603 0.42
604 0.43
605 0.48
606 0.46
607 0.37
608 0.34
609 0.34
610 0.32
611 0.39
612 0.42
613 0.41
614 0.41
615 0.47
616 0.48
617 0.52
618 0.54
619 0.48
620 0.43
621 0.43
622 0.5