FuNGI

P48561

Protein Details

Accession

P48561

Localization Confidence

High

Confidence Score

21.3

NoLS Segment(s)

Position	Sequence	Protein Nature
1-36	MTRLKAKYSPTKGKRKEDKHTKRMRKSSFTRTQKML	Hydrophilic
528-555	IYKLDEPAKKKQKAKKDKREGEIKKSAI	Basic
559-583	PPDFGVSRSKLKRKVKKTDQGSLLH	Hydrophilic

NLS Segment(s)

Position	Sequence
7-26	KYSPTKGKRKEDKHTKRMRK
535-575	AKKKQKAKKDKREGEIKKSAIPSPPPDFGVSRSKLKRKVKK

Subcellular Location(s)

nucl 24, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR043519 NT_sf IPR002058 PAP_assoc IPR002934 Polymerase_NTP_transf_dom IPR045862 Trf4-like
Gene Ontology	GO:0005730 C:nucleolus GO:0031499 C:TRAMP complex GO:0046872 F:metal ion binding GO:1990817 F:poly(A) RNA polymerase activity GO:0007049 P:cell cycle GO:0051301 P:cell division GO:0071044 P:histone mRNA catabolic process GO:0043629 P:ncRNA polyadenylation GO:0071039 P:nuclear polyadenylation-dependent CUT catabolic process GO:0071042 P:nuclear polyadenylation-dependent mRNA catabolic process GO:0071035 P:nuclear polyadenylation-dependent rRNA catabolic process GO:0071036 P:nuclear polyadenylation-dependent snoRNA catabolic process GO:0071037 P:nuclear polyadenylation-dependent snRNA catabolic process GO:0071038 P:nuclear polyadenylation-dependent tRNA catabolic process GO:0071051 P:polyadenylation-dependent snoRNA 3'-end processing GO:0031123 P:RNA 3'-end processing GO:0000292 P:RNA fragment catabolic process GO:0043631 P:RNA polyadenylation GO:0071050 P:sno(s)RNA polyadenylation GO:0034475 P:U4 snRNA 3'-end processing
KEGG	sce:YNL299W -
Pfam	View protein in Pfam PF01909 NTP_transf_2 PF03828 PAP_assoc
CDD	cd05402 NT_PAP_TUTase

Amino Acid Sequences

MTRLKAKYSPTKGKRKEDKHTKRMRKSSFTRTQKMLEVFNDNRSHFNKYESLAIDVEDDDTFGNLVLMENDKSDVDIPVIEEVTSSEDEQRAESSKRNNSLEDNQDFIAFSDSSEDETEQIKEDDDERSSFLLTDEHEVSKLTSQQSLNTESACNVEYPWIRNHCHSKQRRIADWLTSEIKDFVHYISPSKNEIKCRNRTIDKLRRAVKELWSDADLHVFGSFATDLYLPGSDIDCVVNSRNRDKEDRNYIYELARHLKNKGLAIRMEVIVKTRVPIIKFIEPQSQLHIDVSFERTNGLEAAKLIREWLRDSPGLRELVLIIKQFLHSRRLNNVHTGGLGGFTVICLVYSFLNMHPRIKSNDIDVLDNLGVLLIDFFELYGKNFGYDDVAISISDGYASYIPKSCWRTLEPSRSKFSLAIQDPGDPNNNISRGSFNMKDIKKAFAGAFELLVNKCWELNSATFKDRVGKSILGNVIKYRGQKRDFNDERDLVQNKAIIENERYHKRRTRIVQEDLFINDTEDLPVEEIYKLDEPAKKKQKAKKDKREGEIKKSAIPSPPPDFGVSRSKLKRKVKKTDQGSLLHQNNLSIDDLMGLSENDQESDQDQKGRDTPSGQDEKSPLETKTVDAQTRRDYWLSKGQAL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.9
2	0.89
3	0.9
4	0.91
5	0.92
6	0.92
7	0.94
8	0.94
9	0.94
10	0.95
11	0.92
12	0.91
13	0.89
14	0.89
15	0.88
16	0.87
17	0.84
18	0.79
19	0.74
20	0.71
21	0.66
22	0.6
23	0.53
24	0.52
25	0.47
26	0.5
27	0.52
28	0.45
29	0.48
30	0.46
31	0.49
32	0.41
33	0.43
34	0.39
35	0.35
36	0.41
37	0.36
38	0.36
39	0.3
40	0.29
41	0.26
42	0.21
43	0.21
44	0.13
45	0.12
46	0.09
47	0.09
48	0.08
49	0.07
50	0.07
51	0.05
52	0.06
53	0.07
54	0.09
55	0.09
56	0.1
57	0.11
58	0.11
59	0.12
60	0.12
61	0.12
62	0.1
63	0.1
64	0.1
65	0.11
66	0.12
67	0.1
68	0.09
69	0.09
70	0.12
71	0.13
72	0.13
73	0.13
74	0.15
75	0.15
76	0.16
77	0.18
78	0.19
79	0.2
80	0.25
81	0.31
82	0.37
83	0.44
84	0.46
85	0.46
86	0.48
87	0.54
88	0.57
89	0.51
90	0.46
91	0.39
92	0.37
93	0.34
94	0.29
95	0.24
96	0.15
97	0.12
98	0.13
99	0.13
100	0.14
101	0.15
102	0.15
103	0.13
104	0.14
105	0.15
106	0.14
107	0.14
108	0.12
109	0.12
110	0.14
111	0.15
112	0.16
113	0.16
114	0.16
115	0.16
116	0.16
117	0.15
118	0.14
119	0.13
120	0.12
121	0.15
122	0.16
123	0.16
124	0.16
125	0.16
126	0.16
127	0.17
128	0.2
129	0.17
130	0.2
131	0.2
132	0.24
133	0.27
134	0.31
135	0.29
136	0.26
137	0.25
138	0.2
139	0.21
140	0.18
141	0.14
142	0.1
143	0.15
144	0.16
145	0.19
146	0.25
147	0.29
148	0.3
149	0.36
150	0.45
151	0.47
152	0.55
153	0.61
154	0.65
155	0.68
156	0.73
157	0.72
158	0.7
159	0.65
160	0.6
161	0.54
162	0.49
163	0.44
164	0.37
165	0.33
166	0.27
167	0.24
168	0.19
169	0.17
170	0.13
171	0.14
172	0.15
173	0.16
174	0.19
175	0.21
176	0.24
177	0.31
178	0.34
179	0.37
180	0.46
181	0.53
182	0.58
183	0.62
184	0.67
185	0.65
186	0.69
187	0.72
188	0.72
189	0.72
190	0.71
191	0.72
192	0.66
193	0.66
194	0.62
195	0.58
196	0.55
197	0.49
198	0.42
199	0.36
200	0.34
201	0.29
202	0.27
203	0.2
204	0.12
205	0.1
206	0.08
207	0.07
208	0.07
209	0.07
210	0.05
211	0.06
212	0.06
213	0.06
214	0.07
215	0.07
216	0.06
217	0.06
218	0.07
219	0.06
220	0.06
221	0.06
222	0.06
223	0.07
224	0.09
225	0.12
226	0.14
227	0.19
228	0.22
229	0.26
230	0.31
231	0.35
232	0.41
233	0.49
234	0.51
235	0.5
236	0.48
237	0.46
238	0.42
239	0.39
240	0.33
241	0.28
242	0.26
243	0.24
244	0.23
245	0.25
246	0.26
247	0.28
248	0.28
249	0.27
250	0.24
251	0.25
252	0.26
253	0.23
254	0.21
255	0.18
256	0.16
257	0.14
258	0.14
259	0.12
260	0.13
261	0.14
262	0.14
263	0.18
264	0.2
265	0.24
266	0.27
267	0.29
268	0.32
269	0.31
270	0.31
271	0.31
272	0.28
273	0.23
274	0.21
275	0.19
276	0.13
277	0.12
278	0.16
279	0.13
280	0.11
281	0.11
282	0.11
283	0.11
284	0.11
285	0.1
286	0.06
287	0.06
288	0.08
289	0.08
290	0.07
291	0.08
292	0.09
293	0.1
294	0.11
295	0.13
296	0.15
297	0.16
298	0.17
299	0.19
300	0.2
301	0.2
302	0.18
303	0.16
304	0.13
305	0.13
306	0.14
307	0.12
308	0.09
309	0.09
310	0.1
311	0.12
312	0.14
313	0.18
314	0.19
315	0.22
316	0.28
317	0.34
318	0.34
319	0.36
320	0.35
321	0.29
322	0.26
323	0.24
324	0.17
325	0.11
326	0.1
327	0.06
328	0.04
329	0.03
330	0.04
331	0.03
332	0.03
333	0.03
334	0.03
335	0.04
336	0.04
337	0.05
338	0.07
339	0.13
340	0.14
341	0.16
342	0.17
343	0.2
344	0.23
345	0.25
346	0.24
347	0.2
348	0.25
349	0.24
350	0.24
351	0.21
352	0.2
353	0.16
354	0.15
355	0.13
356	0.07
357	0.06
358	0.04
359	0.04
360	0.02
361	0.02
362	0.02
363	0.02
364	0.03
365	0.03
366	0.04
367	0.06
368	0.06
369	0.07
370	0.07
371	0.07
372	0.08
373	0.08
374	0.08
375	0.07
376	0.07
377	0.07
378	0.07
379	0.07
380	0.05
381	0.05
382	0.04
383	0.04
384	0.05
385	0.06
386	0.07
387	0.09
388	0.1
389	0.16
390	0.21
391	0.22
392	0.24
393	0.26
394	0.33
395	0.39
396	0.49
397	0.52
398	0.53
399	0.56
400	0.53
401	0.52
402	0.45
403	0.4
404	0.38
405	0.31
406	0.3
407	0.26
408	0.29
409	0.28
410	0.29
411	0.29
412	0.19
413	0.19
414	0.19
415	0.19
416	0.17
417	0.16
418	0.17
419	0.17
420	0.22
421	0.22
422	0.21
423	0.29
424	0.29
425	0.35
426	0.35
427	0.35
428	0.3
429	0.31
430	0.28
431	0.21
432	0.23
433	0.16
434	0.16
435	0.13
436	0.15
437	0.13
438	0.14
439	0.13
440	0.1
441	0.1
442	0.1
443	0.11
444	0.11
445	0.14
446	0.2
447	0.23
448	0.25
449	0.25
450	0.26
451	0.32
452	0.3
453	0.29
454	0.26
455	0.25
456	0.24
457	0.29
458	0.34
459	0.28
460	0.28
461	0.27
462	0.26
463	0.27
464	0.32
465	0.32
466	0.35
467	0.39
468	0.44
469	0.48
470	0.56
471	0.59
472	0.6
473	0.61
474	0.54
475	0.51
476	0.52
477	0.49
478	0.39
479	0.35
480	0.3
481	0.24
482	0.24
483	0.24
484	0.19
485	0.2
486	0.26
487	0.31
488	0.39
489	0.42
490	0.46
491	0.52
492	0.54
493	0.61
494	0.63
495	0.67
496	0.65
497	0.71
498	0.69
499	0.64
500	0.61
501	0.54
502	0.47
503	0.36
504	0.28
505	0.2
506	0.15
507	0.13
508	0.11
509	0.09
510	0.08
511	0.09
512	0.09
513	0.08
514	0.08
515	0.11
516	0.12
517	0.12
518	0.16
519	0.21
520	0.24
521	0.35
522	0.45
523	0.5
524	0.58
525	0.65
526	0.72
527	0.79
528	0.86
529	0.86
530	0.87
531	0.89
532	0.89
533	0.92
534	0.88
535	0.87
536	0.85
537	0.76
538	0.7
539	0.64
540	0.59
541	0.54
542	0.52
543	0.49
544	0.45
545	0.46
546	0.41
547	0.41
548	0.38
549	0.36
550	0.4
551	0.38
552	0.42
553	0.48
554	0.54
555	0.61
556	0.71
557	0.77
558	0.78
559	0.85
560	0.86
561	0.88
562	0.87
563	0.88
564	0.85
565	0.79
566	0.76
567	0.75
568	0.68
569	0.62
570	0.53
571	0.45
572	0.38
573	0.34
574	0.28
575	0.19
576	0.15
577	0.12
578	0.11
579	0.1
580	0.1
581	0.08
582	0.07
583	0.1
584	0.1
585	0.1
586	0.11
587	0.11
588	0.12
589	0.18
590	0.2
591	0.22
592	0.23
593	0.26
594	0.31
595	0.33
596	0.34
597	0.31
598	0.34
599	0.38
600	0.45
601	0.42
602	0.43
603	0.42
604	0.43
605	0.48
606	0.46
607	0.37
608	0.34
609	0.34
610	0.32
611	0.39
612	0.42
613	0.41
614	0.41
615	0.47
616	0.48
617	0.52
618	0.54
619	0.48
620	0.43
621	0.43
622	0.5

P48561

3D AlphaFold-predicted Structure Viewer