Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08931

Protein Details
Accession Q08931   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-99KTTTSSTKSRTKSKKKDASESKVQRHydrophilic
NLS Segment(s)
PositionSequence
63-91KKAVSPGRVRKHKTTTSSTKSRTKSKKKD
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito_nucl 10.833, mito 5.5, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005635  C:nuclear envelope  
GO:0005640  C:nuclear outer membrane  
GO:0034399  C:nuclear periphery  
GO:0005816  C:spindle pole body  
GO:0000742  P:karyogamy involved in conjugation with cellular fusion  
GO:0048288  P:nuclear membrane fusion involved in karyogamy  
KEGG sce:YPL192C  -  
Amino Acid Sequences MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQHIKKAVSPGRVRKHKTTTSSTKSRTKSKKKDASESKVQRENKGSFYQGAIFGSFLGAAVTTVLSNLAVKALQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.33
4 0.39
5 0.46
6 0.47
7 0.5
8 0.55
9 0.61
10 0.62
11 0.58
12 0.53
13 0.51
14 0.49
15 0.46
16 0.43
17 0.38
18 0.35
19 0.32
20 0.32
21 0.26
22 0.23
23 0.19
24 0.12
25 0.1
26 0.09
27 0.14
28 0.13
29 0.14
30 0.15
31 0.16
32 0.21
33 0.23
34 0.29
35 0.31
36 0.36
37 0.4
38 0.44
39 0.45
40 0.41
41 0.46
42 0.43
43 0.39
44 0.39
45 0.41
46 0.37
47 0.38
48 0.39
49 0.31
50 0.26
51 0.31
52 0.29
53 0.29
54 0.33
55 0.4
56 0.47
57 0.55
58 0.58
59 0.57
60 0.61
61 0.6
62 0.6
63 0.6
64 0.6
65 0.6
66 0.63
67 0.63
68 0.63
69 0.62
70 0.67
71 0.69
72 0.71
73 0.74
74 0.77
75 0.81
76 0.78
77 0.84
78 0.84
79 0.82
80 0.82
81 0.8
82 0.76
83 0.75
84 0.71
85 0.66
86 0.63
87 0.58
88 0.52
89 0.47
90 0.42
91 0.35
92 0.34
93 0.31
94 0.25
95 0.23
96 0.18
97 0.15
98 0.12
99 0.11
100 0.09
101 0.07
102 0.05
103 0.04
104 0.04
105 0.04
106 0.05
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.06
113 0.07