FuNGI

Q01649

Protein Details

Accession

Q01649

Localization Confidence

Medium

Confidence Score

11.5

NoLS Segment(s)

Position	Sequence	Protein Nature
14-39	DPNNVTRDFPKTKRQKVQKREMDMIL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 25.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR031852 Vik1/Cik1_MT-bd
Gene Ontology	GO:0005737 C:cytoplasm GO:0005871 C:kinesin complex GO:0005874 C:microtubule GO:0005634 C:nucleus GO:0005819 C:spindle GO:0005816 C:spindle pole body GO:0008017 F:microtubule binding GO:0003777 F:microtubule motor activity GO:0000742 P:karyogamy involved in conjugation with cellular fusion GO:0051321 P:meiotic cell cycle GO:0000743 P:nuclear migration involved in conjugation with cellular fusion GO:0060236 P:regulation of mitotic spindle organization
KEGG	sce:YMR198W -
Pfam	View protein in Pfam PF16796 Microtub_bd

Amino Acid Sequences

MNNSKIPKLSFHSDPNNVTRDFPKTKRQKVQKREMDMILTPNNNKLNILHSSGSGIRRCYTDDTSATYTKKLTFGGDPKIIERVKNNERKVRKDIDSLLNAISEIEKESVRIHARELPAITLELDAKVKACRELQNEIDGLSTEMDLKDNQCDLQRKNVELSSKNIVSMHAVKVQEFENDLEEELSNAKREWTYKLMEVENLKPDERLTDEMRQLKTEFEEVNRKLFILQNENENECKNYKKELDKKFEIFKKVKNDARIELDGEQERLSKVLKDLQDTHGELKENIKTCRDEFNDFEKRIGEAEVNFHSMELAVVPLKKKLASTSQALTQVQEEKKQVEGEANNWKKKYVNELEKVQQELYTRQNLATSIEEIKGYTRCFAYANERQMPDEFHINYVDRCICENSGEKRVQVFDRVVLEEIHKDHKRLYNECIPFLEKYISKLINCSIIVVSQQPTAPMKKTLLKQLIEQYGENYKMTLNILHLDGSIKHSDVGLDNPTEIRDLSQDEECMNILTLDTKLGKDEESHSMNIYIGSMSTVQLNRELDDAPSVLSHILTKTKQCFVFKINAGENIEKALALAGKLKRTITLPQLD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.61
3	0.59
4	0.54
5	0.51
6	0.46
7	0.46
8	0.48
9	0.47
10	0.52
11	0.58
12	0.67
13	0.75
14	0.82
15	0.84
16	0.87
17	0.92
18	0.91
19	0.89
20	0.86
21	0.78
22	0.72
23	0.64
24	0.59
25	0.54
26	0.49
27	0.42
28	0.41
29	0.41
30	0.36
31	0.34
32	0.29
33	0.28
34	0.27
35	0.31
36	0.25
37	0.22
38	0.26
39	0.29
40	0.34
41	0.33
42	0.31
43	0.28
44	0.28
45	0.31
46	0.33
47	0.33
48	0.33
49	0.32
50	0.36
51	0.39
52	0.43
53	0.41
54	0.37
55	0.35
56	0.32
57	0.32
58	0.27
59	0.24
60	0.27
61	0.31
62	0.37
63	0.4
64	0.39
65	0.38
66	0.44
67	0.42
68	0.38
69	0.37
70	0.39
71	0.44
72	0.52
73	0.59
74	0.6
75	0.67
76	0.72
77	0.74
78	0.73
79	0.68
80	0.65
81	0.65
82	0.64
83	0.6
84	0.54
85	0.47
86	0.39
87	0.34
88	0.27
89	0.2
90	0.12
91	0.1
92	0.1
93	0.09
94	0.1
95	0.11
96	0.17
97	0.21
98	0.21
99	0.22
100	0.26
101	0.28
102	0.31
103	0.31
104	0.25
105	0.22
106	0.22
107	0.2
108	0.15
109	0.14
110	0.11
111	0.11
112	0.1
113	0.1
114	0.12
115	0.13
116	0.15
117	0.18
118	0.23
119	0.27
120	0.33
121	0.34
122	0.36
123	0.35
124	0.32
125	0.28
126	0.22
127	0.18
128	0.13
129	0.11
130	0.08
131	0.08
132	0.09
133	0.09
134	0.1
135	0.12
136	0.12
137	0.13
138	0.18
139	0.24
140	0.25
141	0.34
142	0.37
143	0.36
144	0.39
145	0.4
146	0.4
147	0.36
148	0.39
149	0.36
150	0.32
151	0.31
152	0.28
153	0.26
154	0.24
155	0.25
156	0.23
157	0.21
158	0.21
159	0.2
160	0.22
161	0.22
162	0.19
163	0.18
164	0.16
165	0.12
166	0.13
167	0.13
168	0.12
169	0.11
170	0.1
171	0.11
172	0.11
173	0.1
174	0.09
175	0.1
176	0.11
177	0.13
178	0.17
179	0.19
180	0.21
181	0.24
182	0.27
183	0.27
184	0.29
185	0.31
186	0.29
187	0.31
188	0.3
189	0.26
190	0.23
191	0.22
192	0.2
193	0.19
194	0.2
195	0.18
196	0.22
197	0.27
198	0.33
199	0.34
200	0.34
201	0.32
202	0.29
203	0.26
204	0.24
205	0.2
206	0.18
207	0.26
208	0.25
209	0.28
210	0.27
211	0.25
212	0.23
213	0.25
214	0.25
215	0.23
216	0.23
217	0.26
218	0.29
219	0.3
220	0.3
221	0.28
222	0.26
223	0.21
224	0.23
225	0.18
226	0.21
227	0.25
228	0.33
229	0.42
230	0.49
231	0.56
232	0.58
233	0.6
234	0.64
235	0.64
236	0.62
237	0.57
238	0.53
239	0.53
240	0.56
241	0.56
242	0.54
243	0.52
244	0.47
245	0.49
246	0.44
247	0.37
248	0.3
249	0.29
250	0.24
251	0.21
252	0.18
253	0.13
254	0.12
255	0.11
256	0.1
257	0.08
258	0.08
259	0.13
260	0.14
261	0.17
262	0.2
263	0.22
264	0.25
265	0.26
266	0.27
267	0.24
268	0.23
269	0.2
270	0.2
271	0.21
272	0.2
273	0.2
274	0.21
275	0.2
276	0.21
277	0.28
278	0.28
279	0.27
280	0.27
281	0.35
282	0.4
283	0.38
284	0.38
285	0.31
286	0.28
287	0.25
288	0.23
289	0.15
290	0.08
291	0.11
292	0.11
293	0.12
294	0.12
295	0.11
296	0.1
297	0.09
298	0.08
299	0.06
300	0.05
301	0.04
302	0.06
303	0.06
304	0.07
305	0.08
306	0.09
307	0.09
308	0.11
309	0.16
310	0.18
311	0.21
312	0.21
313	0.24
314	0.28
315	0.28
316	0.26
317	0.21
318	0.25
319	0.23
320	0.25
321	0.22
322	0.19
323	0.21
324	0.21
325	0.2
326	0.17
327	0.17
328	0.18
329	0.27
330	0.33
331	0.35
332	0.35
333	0.35
334	0.33
335	0.33
336	0.39
337	0.37
338	0.4
339	0.41
340	0.46
341	0.51
342	0.51
343	0.51
344	0.42
345	0.35
346	0.27
347	0.25
348	0.24
349	0.23
350	0.21
351	0.2
352	0.2
353	0.19
354	0.19
355	0.17
356	0.15
357	0.13
358	0.13
359	0.13
360	0.12
361	0.14
362	0.14
363	0.14
364	0.13
365	0.12
366	0.12
367	0.13
368	0.15
369	0.21
370	0.25
371	0.32
372	0.35
373	0.36
374	0.36
375	0.36
376	0.36
377	0.29
378	0.29
379	0.22
380	0.18
381	0.2
382	0.2
383	0.19
384	0.2
385	0.2
386	0.14
387	0.15
388	0.16
389	0.15
390	0.16
391	0.23
392	0.24
393	0.29
394	0.3
395	0.29
396	0.29
397	0.32
398	0.3
399	0.28
400	0.24
401	0.2
402	0.22
403	0.22
404	0.22
405	0.19
406	0.19
407	0.18
408	0.19
409	0.24
410	0.23
411	0.23
412	0.27
413	0.32
414	0.37
415	0.38
416	0.43
417	0.44
418	0.45
419	0.46
420	0.43
421	0.39
422	0.34
423	0.33
424	0.3
425	0.21
426	0.22
427	0.27
428	0.27
429	0.25
430	0.26
431	0.25
432	0.26
433	0.26
434	0.24
435	0.18
436	0.15
437	0.16
438	0.17
439	0.17
440	0.13
441	0.13
442	0.14
443	0.17
444	0.2
445	0.21
446	0.22
447	0.24
448	0.29
449	0.33
450	0.4
451	0.44
452	0.43
453	0.45
454	0.5
455	0.52
456	0.47
457	0.44
458	0.37
459	0.35
460	0.36
461	0.31
462	0.24
463	0.18
464	0.17
465	0.18
466	0.16
467	0.12
468	0.12
469	0.13
470	0.13
471	0.13
472	0.13
473	0.13
474	0.16
475	0.16
476	0.14
477	0.14
478	0.14
479	0.14
480	0.14
481	0.16
482	0.16
483	0.15
484	0.15
485	0.15
486	0.16
487	0.15
488	0.14
489	0.12
490	0.11
491	0.13
492	0.15
493	0.16
494	0.17
495	0.16
496	0.17
497	0.16
498	0.15
499	0.13
500	0.1
501	0.08
502	0.09
503	0.09
504	0.11
505	0.12
506	0.11
507	0.13
508	0.14
509	0.15
510	0.16
511	0.2
512	0.24
513	0.26
514	0.27
515	0.26
516	0.26
517	0.26
518	0.23
519	0.2
520	0.13
521	0.09
522	0.09
523	0.08
524	0.08
525	0.13
526	0.14
527	0.14
528	0.19
529	0.2
530	0.19
531	0.2
532	0.21
533	0.17
534	0.18
535	0.17
536	0.13
537	0.12
538	0.12
539	0.11
540	0.1
541	0.11
542	0.11
543	0.17
544	0.2
545	0.27
546	0.31
547	0.38
548	0.44
549	0.46
550	0.48
551	0.46
552	0.53
553	0.51
554	0.54
555	0.5
556	0.51
557	0.52
558	0.49
559	0.45
560	0.38
561	0.33
562	0.24
563	0.21
564	0.17
565	0.13
566	0.12
567	0.19
568	0.2
569	0.24
570	0.27
571	0.28
572	0.28
573	0.3
574	0.36

Q01649

3D AlphaFold-predicted Structure Viewer