Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G1E1

Protein Details
Accession A0A0K6G1E1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-24TRQHTTKPTARGRKSNLRNGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPLTRQHTTKPTARGRKSNLRNGAVLALSQAAKFVSLPLAHEVVRHVKEAMVALKAPKANDSSAKDLEDYVAGLLNAFDTALPMLSQNGDLDRLCGLLRIRDAHAELVRIQTSQYTEKLASQAQIRDQVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.79
4 0.81
5 0.82
6 0.8
7 0.73
8 0.66
9 0.58
10 0.52
11 0.41
12 0.32
13 0.23
14 0.16
15 0.12
16 0.11
17 0.1
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.08
24 0.1
25 0.12
26 0.14
27 0.13
28 0.14
29 0.15
30 0.19
31 0.19
32 0.19
33 0.17
34 0.15
35 0.16
36 0.17
37 0.16
38 0.11
39 0.11
40 0.1
41 0.13
42 0.14
43 0.13
44 0.13
45 0.13
46 0.13
47 0.18
48 0.21
49 0.23
50 0.23
51 0.24
52 0.22
53 0.2
54 0.19
55 0.14
56 0.11
57 0.06
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.1
83 0.1
84 0.11
85 0.14
86 0.16
87 0.17
88 0.19
89 0.2
90 0.23
91 0.23
92 0.22
93 0.21
94 0.22
95 0.22
96 0.19
97 0.18
98 0.16
99 0.18
100 0.2
101 0.2
102 0.2
103 0.2
104 0.22
105 0.25
106 0.25
107 0.24
108 0.26
109 0.28
110 0.29