Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P53080

Protein Details
Accession P53080    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-37AGRNKTNNLIKQKTRNNRARGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
GO:0098745  C:Dcp1-Dcp2 complex  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0006397  P:mRNA processing  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
GO:0032056  P:positive regulation of translation in response to stress  
KEGG sce:YGL222C  -  
Amino Acid Sequences MSTDTMYFNSSRLLPSAGRNKTNNLIKQKTRNNRARGNAAKNANNNNYITDIPPPQTLPNGQKPNFGHSSNKKPSFNQKKHSPPSSPSSTTTLGKKNRQNNKETPRQNNKDDTRLLSQNLKNLLLNQKQSPHGSQGIIPMGCNGSAKKLSHSYAGSTFATNGPREAKNLPKPSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.34
4 0.38
5 0.44
6 0.44
7 0.48
8 0.53
9 0.6
10 0.6
11 0.6
12 0.62
13 0.63
14 0.71
15 0.76
16 0.78
17 0.8
18 0.82
19 0.8
20 0.8
21 0.79
22 0.79
23 0.77
24 0.74
25 0.71
26 0.68
27 0.66
28 0.63
29 0.64
30 0.57
31 0.51
32 0.44
33 0.38
34 0.34
35 0.29
36 0.24
37 0.2
38 0.18
39 0.17
40 0.18
41 0.18
42 0.16
43 0.17
44 0.2
45 0.23
46 0.31
47 0.38
48 0.37
49 0.43
50 0.43
51 0.47
52 0.47
53 0.42
54 0.41
55 0.39
56 0.49
57 0.51
58 0.56
59 0.52
60 0.51
61 0.6
62 0.63
63 0.64
64 0.62
65 0.62
66 0.66
67 0.71
68 0.74
69 0.66
70 0.58
71 0.58
72 0.56
73 0.49
74 0.41
75 0.38
76 0.35
77 0.34
78 0.34
79 0.34
80 0.34
81 0.39
82 0.44
83 0.49
84 0.56
85 0.59
86 0.62
87 0.65
88 0.67
89 0.69
90 0.7
91 0.71
92 0.72
93 0.73
94 0.71
95 0.71
96 0.66
97 0.62
98 0.57
99 0.51
100 0.46
101 0.42
102 0.4
103 0.38
104 0.36
105 0.35
106 0.35
107 0.32
108 0.27
109 0.28
110 0.34
111 0.31
112 0.33
113 0.32
114 0.33
115 0.36
116 0.38
117 0.36
118 0.33
119 0.3
120 0.28
121 0.26
122 0.26
123 0.28
124 0.25
125 0.23
126 0.19
127 0.17
128 0.17
129 0.17
130 0.13
131 0.13
132 0.18
133 0.19
134 0.23
135 0.27
136 0.28
137 0.32
138 0.33
139 0.32
140 0.3
141 0.34
142 0.3
143 0.26
144 0.25
145 0.23
146 0.26
147 0.23
148 0.23
149 0.24
150 0.24
151 0.27
152 0.31
153 0.37
154 0.43
155 0.53