Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P48836

Protein Details
Accession P48836   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-38HEIVSKARKYRQDKLKQAKTDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.333, nucl 13, cyto 12.5, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR005124  V-ATPase_G  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
GO:0033176  C:proton-transporting V-type ATPase complex  
GO:0016471  C:vacuolar proton-transporting V-type ATPase complex  
GO:0000221  C:vacuolar proton-transporting V-type ATPase, V1 domain  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
GO:0048388  P:endosomal lumen acidification  
GO:0061795  P:Golgi lumen acidification  
GO:1902600  P:proton transmembrane transport  
GO:0007035  P:vacuolar acidification  
KEGG sce:YHR039C-A  -  
Pfam View protein in Pfam  
PF03179  V-ATPase_G  
Amino Acid Sequences MSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQKNAGGVGELEKKAEAGVQGELAEIKKIAEKKKDDVVKILIETVIKPSAEVHINAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.13
5 0.11
6 0.12
7 0.16
8 0.24
9 0.26
10 0.28
11 0.34
12 0.43
13 0.49
14 0.58
15 0.64
16 0.66
17 0.74
18 0.81
19 0.84
20 0.79
21 0.76
22 0.73
23 0.66
24 0.61
25 0.54
26 0.46
27 0.36
28 0.32
29 0.3
30 0.26
31 0.23
32 0.2
33 0.2
34 0.23
35 0.22
36 0.26
37 0.31
38 0.34
39 0.4
40 0.44
41 0.42
42 0.46
43 0.49
44 0.46
45 0.45
46 0.4
47 0.32
48 0.27
49 0.25
50 0.16
51 0.13
52 0.14
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.09
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.06
70 0.06
71 0.1
72 0.15
73 0.21
74 0.28
75 0.32
76 0.36
77 0.45
78 0.51
79 0.49
80 0.49
81 0.47
82 0.43
83 0.39
84 0.36
85 0.28
86 0.22
87 0.21
88 0.2
89 0.19
90 0.15
91 0.15
92 0.15
93 0.18
94 0.2