Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G2P9

Protein Details
Accession A0A0K6G2P9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26AQRVTIRKRTPYNTKSNRRRVVKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTIRKRTPYNTKSNRRRVVKTPGGKLVYQHLKKLATAPKCGDCGVALPGVPALRPRQYATISKRQKTVRRAYGGSRCGDCVKQRILRAFLIEEAKIVKKVIKSQEKATPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.85
4 0.88
5 0.89
6 0.86
7 0.84
8 0.8
9 0.8
10 0.79
11 0.76
12 0.72
13 0.7
14 0.65
15 0.59
16 0.53
17 0.51
18 0.51
19 0.45
20 0.41
21 0.37
22 0.34
23 0.34
24 0.4
25 0.38
26 0.31
27 0.34
28 0.35
29 0.34
30 0.34
31 0.34
32 0.27
33 0.2
34 0.18
35 0.15
36 0.12
37 0.08
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.08
44 0.1
45 0.11
46 0.12
47 0.15
48 0.18
49 0.25
50 0.3
51 0.39
52 0.44
53 0.45
54 0.51
55 0.54
56 0.59
57 0.6
58 0.64
59 0.62
60 0.6
61 0.6
62 0.61
63 0.63
64 0.6
65 0.54
66 0.45
67 0.39
68 0.35
69 0.36
70 0.32
71 0.29
72 0.32
73 0.34
74 0.38
75 0.41
76 0.42
77 0.4
78 0.4
79 0.36
80 0.32
81 0.3
82 0.26
83 0.21
84 0.21
85 0.21
86 0.2
87 0.19
88 0.19
89 0.19
90 0.27
91 0.37
92 0.44
93 0.46
94 0.52
95 0.61