Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FTH4

Protein Details
Accession A0A0K6FTH4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-83DEQSISSKKKRSHKSHKLDKAKLIVKQQEKNRRLARKKLRQSKGSHydrophilic
NLS Segment(s)
PositionSequence
46-83KKKRSHKSHKLDKAKLIVKQQEKNRRLARKKLRQSKGS
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MIRMVKKLLESKNEELTLAAQVIQSVENARMKRPSVAEDEQSISSKKKRSHKSHKLDKAKLIVKQQEKNRRLARKKLRQSKGSIPSSEEKPKGTNSSVTSSNIRGAPDRRMKRVSFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.35
4 0.28
5 0.21
6 0.17
7 0.09
8 0.09
9 0.09
10 0.09
11 0.08
12 0.08
13 0.11
14 0.15
15 0.16
16 0.18
17 0.21
18 0.22
19 0.25
20 0.26
21 0.26
22 0.28
23 0.31
24 0.31
25 0.29
26 0.3
27 0.28
28 0.28
29 0.26
30 0.21
31 0.22
32 0.26
33 0.3
34 0.37
35 0.46
36 0.55
37 0.66
38 0.74
39 0.8
40 0.85
41 0.89
42 0.89
43 0.83
44 0.76
45 0.73
46 0.65
47 0.59
48 0.54
49 0.51
50 0.47
51 0.5
52 0.54
53 0.57
54 0.56
55 0.6
56 0.63
57 0.66
58 0.66
59 0.7
60 0.73
61 0.73
62 0.81
63 0.83
64 0.84
65 0.79
66 0.79
67 0.78
68 0.77
69 0.72
70 0.63
71 0.57
72 0.53
73 0.54
74 0.55
75 0.46
76 0.39
77 0.35
78 0.38
79 0.38
80 0.36
81 0.35
82 0.31
83 0.34
84 0.35
85 0.36
86 0.35
87 0.32
88 0.33
89 0.3
90 0.28
91 0.29
92 0.29
93 0.35
94 0.43
95 0.48
96 0.51
97 0.56