Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P11632

Protein Details
Accession P11632    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVTPREPKKRTTRKKKDPNAPKRALSAHydrophilic
NLS Segment(s)
PositionSequence
5-23REPKKRTTRKKKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0032993  C:protein-DNA complex  
GO:0008301  F:DNA binding, bending  
GO:0032407  F:MutSalpha complex binding  
GO:0003676  F:nucleic acid binding  
GO:0031491  F:nucleosome binding  
GO:0006325  P:chromatin organization  
GO:0006338  P:chromatin remodeling  
GO:0001195  P:maintenance of transcriptional fidelity during transcription elongation by RNA polymerase III  
GO:0006298  P:mismatch repair  
GO:0043392  P:negative regulation of DNA binding  
GO:0065004  P:protein-DNA complex assembly  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
GO:0070898  P:RNA polymerase III preinitiation complex assembly  
KEGG sce:YPR052C  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNATLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.95
4 0.95
5 0.95
6 0.94
7 0.89
8 0.8
9 0.74
10 0.65
11 0.58
12 0.49
13 0.4
14 0.32
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.13
26 0.16
27 0.17
28 0.18
29 0.21
30 0.21
31 0.21
32 0.2
33 0.2
34 0.16
35 0.13
36 0.13
37 0.12
38 0.12
39 0.11
40 0.13
41 0.15
42 0.2
43 0.26
44 0.25
45 0.26
46 0.31
47 0.34
48 0.34
49 0.37
50 0.34
51 0.39
52 0.44
53 0.42
54 0.39
55 0.37
56 0.38
57 0.37
58 0.38
59 0.31
60 0.33
61 0.41
62 0.47
63 0.52
64 0.53
65 0.53
66 0.59
67 0.6
68 0.58
69 0.56
70 0.54
71 0.54
72 0.53
73 0.51