Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FRG8

Protein Details
Accession A0A0K6FRG8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-97RTLTKSPTKTIRKKQVRGKQHydrophilic
NLS Segment(s)
PositionSequence
73-95PRKRQRTLTKSPTKTIRKKQVRG
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences MAITRSSTRLASAKGKGVKRIKSEEVDDPMLLDQPSEKVKLEEKGKGQIKVEEPEVKSESEYDQSEDEEQPPPRKRQRTLTKSPTKTIRKKQVRGKQGGLAGLVNMPIDIFTEITSYLFPIDIISLSRANKSFRRLLMDRSSIHIWHSTMRNVRGLPPCPPDLTEPHYLSLLFSKHCTMCVSMIPPVVSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.54
4 0.58
5 0.61
6 0.6
7 0.64
8 0.62
9 0.59
10 0.6
11 0.58
12 0.56
13 0.51
14 0.43
15 0.37
16 0.31
17 0.28
18 0.23
19 0.16
20 0.11
21 0.11
22 0.14
23 0.15
24 0.15
25 0.15
26 0.19
27 0.26
28 0.3
29 0.33
30 0.34
31 0.41
32 0.45
33 0.47
34 0.45
35 0.43
36 0.42
37 0.39
38 0.41
39 0.38
40 0.34
41 0.35
42 0.35
43 0.3
44 0.26
45 0.24
46 0.22
47 0.18
48 0.18
49 0.15
50 0.14
51 0.15
52 0.17
53 0.17
54 0.17
55 0.18
56 0.2
57 0.26
58 0.3
59 0.37
60 0.43
61 0.49
62 0.51
63 0.57
64 0.65
65 0.67
66 0.72
67 0.75
68 0.77
69 0.74
70 0.75
71 0.74
72 0.73
73 0.73
74 0.72
75 0.72
76 0.71
77 0.76
78 0.81
79 0.79
80 0.79
81 0.75
82 0.69
83 0.62
84 0.54
85 0.47
86 0.37
87 0.28
88 0.2
89 0.14
90 0.11
91 0.07
92 0.05
93 0.04
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.07
112 0.1
113 0.1
114 0.13
115 0.15
116 0.18
117 0.21
118 0.26
119 0.29
120 0.29
121 0.36
122 0.36
123 0.41
124 0.45
125 0.47
126 0.43
127 0.42
128 0.42
129 0.35
130 0.34
131 0.3
132 0.23
133 0.23
134 0.25
135 0.26
136 0.29
137 0.31
138 0.34
139 0.32
140 0.39
141 0.41
142 0.41
143 0.41
144 0.4
145 0.41
146 0.38
147 0.39
148 0.35
149 0.33
150 0.35
151 0.37
152 0.34
153 0.33
154 0.32
155 0.3
156 0.28
157 0.27
158 0.25
159 0.18
160 0.19
161 0.22
162 0.22
163 0.23
164 0.25
165 0.22
166 0.22
167 0.25
168 0.26
169 0.25
170 0.27
171 0.26