Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G314

Protein Details
Accession A0A0K6G314   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
52-72DPDLGNRKRKAKKSKEVIEDEBasic
NLS Segment(s)
PositionSequence
58-66RKRKAKKSK
Subcellular Location(s) cyto_nucl 12.833, cyto 12, nucl 9.5, mito_nucl 8.332, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAQTPDGKWIQVRVGYQQAGSQLVPPQLAAAYGAGSRQSTEVPAAYANIVIDPDLGNRKRKAKKSKEVIEDEVDDTGEGPSVAGPSRLPSNAGKPSRVHLKVKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.29
4 0.28
5 0.25
6 0.23
7 0.22
8 0.19
9 0.16
10 0.17
11 0.16
12 0.14
13 0.13
14 0.11
15 0.11
16 0.09
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.07
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.05
41 0.11
42 0.13
43 0.17
44 0.21
45 0.3
46 0.37
47 0.46
48 0.56
49 0.61
50 0.69
51 0.75
52 0.81
53 0.81
54 0.79
55 0.73
56 0.66
57 0.57
58 0.48
59 0.38
60 0.29
61 0.2
62 0.14
63 0.1
64 0.07
65 0.05
66 0.04
67 0.04
68 0.05
69 0.06
70 0.06
71 0.06
72 0.08
73 0.12
74 0.13
75 0.15
76 0.17
77 0.24
78 0.33
79 0.37
80 0.38
81 0.37
82 0.43
83 0.5
84 0.54
85 0.51