Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40023

Protein Details
Accession P40023    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-66GKKPNFGKSTKQRREPRERTSKTBasic
83-112FLHDKAPKKKSCKYKKKKTRQYQDRAAASIHydrophilic
NLS Segment(s)
PositionSequence
50-60GKSTKQRREPR
88-101APKKKSCKYKKKKT
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0006397  P:mRNA processing  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
GO:0032056  P:positive regulation of translation in response to stress  
KEGG sce:YER035W  -  
Amino Acid Sequences MGSETKHSAKVKIVTRESPPSAKEHMRPTKTQILVPPTQSLPNGKKPNFGKSTKQRREPRERTSKTGHEDDKATMVTVNIDAFLHDKAPKKKSCKYKKKKTRQYQDRAAASIDSKPHVAGHTAFAGASFTTDIPHEAALPKPSFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.61
4 0.59
5 0.56
6 0.49
7 0.44
8 0.45
9 0.46
10 0.45
11 0.48
12 0.53
13 0.54
14 0.55
15 0.57
16 0.6
17 0.56
18 0.54
19 0.49
20 0.45
21 0.44
22 0.43
23 0.4
24 0.32
25 0.31
26 0.3
27 0.31
28 0.29
29 0.36
30 0.43
31 0.4
32 0.46
33 0.47
34 0.55
35 0.55
36 0.54
37 0.54
38 0.56
39 0.67
40 0.67
41 0.75
42 0.74
43 0.77
44 0.85
45 0.83
46 0.82
47 0.82
48 0.77
49 0.73
50 0.71
51 0.67
52 0.61
53 0.6
54 0.51
55 0.42
56 0.39
57 0.34
58 0.29
59 0.23
60 0.18
61 0.12
62 0.1
63 0.08
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.1
73 0.17
74 0.22
75 0.3
76 0.36
77 0.42
78 0.49
79 0.59
80 0.67
81 0.72
82 0.77
83 0.82
84 0.87
85 0.92
86 0.95
87 0.95
88 0.95
89 0.95
90 0.94
91 0.92
92 0.9
93 0.82
94 0.72
95 0.62
96 0.52
97 0.42
98 0.36
99 0.27
100 0.19
101 0.16
102 0.15
103 0.15
104 0.15
105 0.16
106 0.14
107 0.15
108 0.15
109 0.15
110 0.14
111 0.13
112 0.13
113 0.1
114 0.1
115 0.08
116 0.07
117 0.08
118 0.08
119 0.1
120 0.1
121 0.1
122 0.11
123 0.12
124 0.16
125 0.22