Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FPM9

Protein Details
Accession A0A0K6FPM9    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-55PAPTPTAKPKASKKKKKPDTSTSDTTNHydrophilic
NLS Segment(s)
PositionSequence
35-46AKPKASKKKKKP
60-81REGAAPVKAAKPKKQKVGKAAN
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MTLFLDTSAEPGPTTPAQRSGSVNSEDAPAPTPTAKPKASKKKKKPDTSTSDTTNENNKREGAAPVKAAKPKKQKVGKAANGKPLAFQPSDLEEFATASVASPSPGKPSSTVSRVPSKLQNSQTPISPSNSSTTTPTHTPKIASAAVPSAAGGSAPPRMARGTGPPRPLLGRGPSIPRTGGAVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.26
4 0.28
5 0.31
6 0.34
7 0.34
8 0.36
9 0.36
10 0.34
11 0.28
12 0.28
13 0.25
14 0.23
15 0.21
16 0.16
17 0.15
18 0.16
19 0.17
20 0.2
21 0.26
22 0.29
23 0.34
24 0.44
25 0.54
26 0.64
27 0.73
28 0.78
29 0.83
30 0.9
31 0.94
32 0.92
33 0.91
34 0.89
35 0.86
36 0.81
37 0.75
38 0.67
39 0.58
40 0.51
41 0.5
42 0.46
43 0.4
44 0.36
45 0.31
46 0.3
47 0.29
48 0.31
49 0.25
50 0.22
51 0.23
52 0.25
53 0.28
54 0.32
55 0.34
56 0.38
57 0.45
58 0.49
59 0.55
60 0.6
61 0.61
62 0.66
63 0.73
64 0.73
65 0.72
66 0.71
67 0.69
68 0.64
69 0.58
70 0.49
71 0.4
72 0.35
73 0.25
74 0.21
75 0.14
76 0.14
77 0.16
78 0.15
79 0.13
80 0.1
81 0.1
82 0.09
83 0.08
84 0.05
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.06
91 0.09
92 0.1
93 0.11
94 0.12
95 0.16
96 0.21
97 0.24
98 0.27
99 0.27
100 0.34
101 0.35
102 0.37
103 0.39
104 0.39
105 0.43
106 0.43
107 0.45
108 0.43
109 0.43
110 0.43
111 0.41
112 0.38
113 0.34
114 0.31
115 0.27
116 0.25
117 0.25
118 0.23
119 0.21
120 0.21
121 0.21
122 0.24
123 0.27
124 0.27
125 0.27
126 0.27
127 0.26
128 0.29
129 0.27
130 0.23
131 0.21
132 0.19
133 0.18
134 0.16
135 0.15
136 0.1
137 0.08
138 0.07
139 0.06
140 0.06
141 0.08
142 0.09
143 0.09
144 0.11
145 0.12
146 0.13
147 0.15
148 0.23
149 0.31
150 0.37
151 0.41
152 0.41
153 0.42
154 0.44
155 0.45
156 0.41
157 0.37
158 0.36
159 0.36
160 0.42
161 0.43
162 0.43
163 0.41
164 0.36
165 0.35