Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38431

Protein Details
Accession P38431   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
363-388RFGTKSSKKFVPKEVSKKVRRAAKPFHydrophilic
NLS Segment(s)
PositionSequence
152-156KKKKK
374-384PKEVSKKVRRA
Subcellular Location(s) nucl 14, cyto 10.5, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR045196  IF2/IF5  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
IPR003307  W2_domain  
Gene Ontology GO:0005829  C:cytosol  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0043614  C:multi-eIF complex  
GO:0071074  F:eukaryotic initiation factor eIF2 binding  
GO:0005092  F:GDP-dissociation inhibitor activity  
GO:0005525  F:GTP binding  
GO:0005096  F:GTPase activator activity  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0042256  P:cytosolic ribosome assembly  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
GO:0001731  P:formation of translation preinitiation complex  
GO:0045947  P:negative regulation of translational initiation  
GO:0006446  P:regulation of translational initiation  
KEGG sce:YPR041W  -  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
PF02020  W2  
PROSITE View protein in PROSITE  
PS51363  W2  
CDD cd11561  W2_eIF5  
Amino Acid Sequences MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSVSGSKKKKKAATASANVRGGGLSISDIAQGKSQNAPSDGTGSSTPQHHDEDEDELSRQIKAAASTLEDIEVKDDEWAVDMSEEAIRARAKELEVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAESDDDEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.55
4 0.56
5 0.56
6 0.62
7 0.65
8 0.62
9 0.62
10 0.64
11 0.61
12 0.6
13 0.55
14 0.5
15 0.49
16 0.44
17 0.38
18 0.34
19 0.29
20 0.22
21 0.23
22 0.22
23 0.16
24 0.15
25 0.13
26 0.13
27 0.12
28 0.12
29 0.1
30 0.12
31 0.13
32 0.14
33 0.17
34 0.18
35 0.19
36 0.22
37 0.22
38 0.21
39 0.23
40 0.25
41 0.23
42 0.24
43 0.23
44 0.22
45 0.22
46 0.19
47 0.17
48 0.16
49 0.15
50 0.14
51 0.12
52 0.11
53 0.11
54 0.12
55 0.11
56 0.1
57 0.11
58 0.13
59 0.13
60 0.14
61 0.17
62 0.17
63 0.2
64 0.25
65 0.25
66 0.27
67 0.26
68 0.25
69 0.23
70 0.24
71 0.2
72 0.14
73 0.15
74 0.12
75 0.14
76 0.15
77 0.16
78 0.14
79 0.15
80 0.15
81 0.12
82 0.11
83 0.11
84 0.11
85 0.11
86 0.14
87 0.17
88 0.24
89 0.26
90 0.28
91 0.28
92 0.28
93 0.31
94 0.29
95 0.3
96 0.25
97 0.27
98 0.25
99 0.25
100 0.26
101 0.23
102 0.21
103 0.19
104 0.18
105 0.18
106 0.2
107 0.2
108 0.24
109 0.29
110 0.32
111 0.35
112 0.41
113 0.43
114 0.49
115 0.58
116 0.59
117 0.64
118 0.68
119 0.67
120 0.66
121 0.62
122 0.55
123 0.47
124 0.47
125 0.39
126 0.37
127 0.4
128 0.36
129 0.37
130 0.36
131 0.35
132 0.29
133 0.29
134 0.27
135 0.28
136 0.36
137 0.44
138 0.5
139 0.53
140 0.58
141 0.61
142 0.63
143 0.63
144 0.64
145 0.64
146 0.66
147 0.69
148 0.68
149 0.63
150 0.56
151 0.47
152 0.36
153 0.27
154 0.18
155 0.11
156 0.05
157 0.04
158 0.04
159 0.06
160 0.07
161 0.07
162 0.08
163 0.09
164 0.1
165 0.12
166 0.13
167 0.13
168 0.14
169 0.14
170 0.13
171 0.16
172 0.14
173 0.13
174 0.13
175 0.12
176 0.12
177 0.13
178 0.14
179 0.13
180 0.14
181 0.13
182 0.13
183 0.13
184 0.15
185 0.15
186 0.14
187 0.12
188 0.12
189 0.12
190 0.11
191 0.1
192 0.07
193 0.07
194 0.07
195 0.08
196 0.07
197 0.08
198 0.09
199 0.09
200 0.09
201 0.08
202 0.08
203 0.08
204 0.07
205 0.06
206 0.06
207 0.06
208 0.05
209 0.06
210 0.06
211 0.05
212 0.05
213 0.04
214 0.05
215 0.05
216 0.06
217 0.05
218 0.07
219 0.07
220 0.07
221 0.09
222 0.1
223 0.1
224 0.13
225 0.14
226 0.18
227 0.19
228 0.21
229 0.2
230 0.21
231 0.2
232 0.16
233 0.16
234 0.1
235 0.09
236 0.06
237 0.07
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.04
244 0.04
245 0.06
246 0.06
247 0.07
248 0.08
249 0.08
250 0.1
251 0.1
252 0.11
253 0.09
254 0.08
255 0.1
256 0.12
257 0.12
258 0.12
259 0.13
260 0.13
261 0.13
262 0.13
263 0.12
264 0.11
265 0.1
266 0.12
267 0.18
268 0.19
269 0.18
270 0.19
271 0.18
272 0.17
273 0.17
274 0.14
275 0.06
276 0.06
277 0.09
278 0.11
279 0.12
280 0.12
281 0.13
282 0.13
283 0.13
284 0.13
285 0.1
286 0.09
287 0.09
288 0.09
289 0.07
290 0.07
291 0.07
292 0.07
293 0.07
294 0.06
295 0.06
296 0.06
297 0.07
298 0.07
299 0.08
300 0.1
301 0.12
302 0.13
303 0.14
304 0.19
305 0.26
306 0.29
307 0.29
308 0.27
309 0.25
310 0.24
311 0.22
312 0.21
313 0.15
314 0.14
315 0.14
316 0.14
317 0.13
318 0.13
319 0.16
320 0.13
321 0.14
322 0.15
323 0.13
324 0.13
325 0.14
326 0.14
327 0.17
328 0.17
329 0.16
330 0.14
331 0.14
332 0.15
333 0.19
334 0.21
335 0.17
336 0.21
337 0.23
338 0.26
339 0.26
340 0.24
341 0.21
342 0.19
343 0.2
344 0.17
345 0.15
346 0.11
347 0.12
348 0.12
349 0.13
350 0.12
351 0.11
352 0.18
353 0.24
354 0.28
355 0.34
356 0.42
357 0.5
358 0.56
359 0.65
360 0.66
361 0.7
362 0.77
363 0.81
364 0.84
365 0.83
366 0.86
367 0.84
368 0.83
369 0.81
370 0.79
371 0.79
372 0.77
373 0.75
374 0.74
375 0.72
376 0.66
377 0.57
378 0.51
379 0.46
380 0.36
381 0.32
382 0.27
383 0.21
384 0.18
385 0.18