Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FRN7

Protein Details
Accession A0A0K6FRN7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
294-325GTSYRDASRSRSRERRSRSPIGRRRGGRYERDBasic
NLS Segment(s)
PositionSequence
215-322EGEPGGHWRGGGAGGGRGRPAGLVRGGGHLAFGRERDPPGRDPPGRDLPPPRNRDGPGPGPDRRGGGSGRRPSPDMTRGGTSYRDASRSRSRERRSRSPIGRRRGGRY
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MTTEVEKIPVDRTKTCPFLLRTFVRSGGFHPETTFENGRVPTLDEHAVHVWSTSTLIDVVRALRAQTPSPSLPAGAFRNPATKYAFRAIFYDRGNVTSKDLGQVGPRDLNDISALYSSSPGQMPTPPTEPTDLPADSAMDADDDAPRKDRDDEDIPATGTNPSGGNRAKAGARTLDELRVQPGDWLSVSITLPASAKPVVGPAGLAIRGAEREREGEPGGHWRGGGAGGGRGRPAGLVRGGGHLAFGRERDPPGRDPPGRDLPPPRNRDGPGPGPDRRGGGSGRRPSPDMTRGGTSYRDASRSRSRERRSRSPIGRRRGGRYERD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.49
4 0.48
5 0.49
6 0.54
7 0.52
8 0.49
9 0.48
10 0.49
11 0.44
12 0.4
13 0.36
14 0.38
15 0.35
16 0.31
17 0.28
18 0.27
19 0.27
20 0.33
21 0.33
22 0.24
23 0.27
24 0.26
25 0.27
26 0.25
27 0.25
28 0.2
29 0.21
30 0.24
31 0.19
32 0.22
33 0.22
34 0.22
35 0.19
36 0.18
37 0.15
38 0.11
39 0.12
40 0.08
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.14
51 0.17
52 0.18
53 0.19
54 0.24
55 0.23
56 0.25
57 0.24
58 0.21
59 0.19
60 0.22
61 0.23
62 0.21
63 0.22
64 0.21
65 0.26
66 0.27
67 0.29
68 0.3
69 0.28
70 0.29
71 0.34
72 0.35
73 0.3
74 0.32
75 0.33
76 0.33
77 0.32
78 0.33
79 0.26
80 0.26
81 0.29
82 0.27
83 0.26
84 0.23
85 0.22
86 0.19
87 0.19
88 0.17
89 0.17
90 0.19
91 0.18
92 0.18
93 0.18
94 0.19
95 0.18
96 0.18
97 0.15
98 0.13
99 0.11
100 0.09
101 0.09
102 0.07
103 0.07
104 0.07
105 0.08
106 0.08
107 0.08
108 0.08
109 0.11
110 0.13
111 0.16
112 0.18
113 0.18
114 0.19
115 0.21
116 0.2
117 0.19
118 0.21
119 0.17
120 0.15
121 0.14
122 0.13
123 0.11
124 0.11
125 0.09
126 0.05
127 0.05
128 0.05
129 0.06
130 0.07
131 0.07
132 0.1
133 0.1
134 0.11
135 0.13
136 0.14
137 0.17
138 0.2
139 0.22
140 0.22
141 0.22
142 0.21
143 0.19
144 0.19
145 0.14
146 0.1
147 0.08
148 0.07
149 0.06
150 0.1
151 0.11
152 0.11
153 0.11
154 0.13
155 0.13
156 0.13
157 0.14
158 0.12
159 0.12
160 0.15
161 0.15
162 0.16
163 0.17
164 0.16
165 0.16
166 0.15
167 0.14
168 0.12
169 0.11
170 0.09
171 0.08
172 0.08
173 0.07
174 0.08
175 0.08
176 0.08
177 0.08
178 0.07
179 0.08
180 0.07
181 0.09
182 0.07
183 0.08
184 0.07
185 0.08
186 0.08
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.07
193 0.06
194 0.06
195 0.08
196 0.08
197 0.09
198 0.08
199 0.1
200 0.11
201 0.13
202 0.14
203 0.13
204 0.14
205 0.21
206 0.22
207 0.2
208 0.19
209 0.16
210 0.16
211 0.15
212 0.15
213 0.08
214 0.09
215 0.1
216 0.11
217 0.11
218 0.11
219 0.1
220 0.1
221 0.1
222 0.1
223 0.09
224 0.11
225 0.12
226 0.14
227 0.14
228 0.14
229 0.14
230 0.12
231 0.12
232 0.11
233 0.11
234 0.1
235 0.12
236 0.15
237 0.18
238 0.22
239 0.25
240 0.31
241 0.4
242 0.41
243 0.44
244 0.49
245 0.55
246 0.54
247 0.55
248 0.56
249 0.57
250 0.64
251 0.65
252 0.61
253 0.58
254 0.57
255 0.58
256 0.57
257 0.54
258 0.53
259 0.54
260 0.53
261 0.51
262 0.51
263 0.47
264 0.41
265 0.36
266 0.31
267 0.33
268 0.39
269 0.44
270 0.48
271 0.49
272 0.49
273 0.49
274 0.54
275 0.51
276 0.46
277 0.41
278 0.4
279 0.38
280 0.39
281 0.38
282 0.33
283 0.33
284 0.32
285 0.33
286 0.3
287 0.36
288 0.44
289 0.5
290 0.58
291 0.62
292 0.67
293 0.72
294 0.8
295 0.84
296 0.83
297 0.85
298 0.86
299 0.87
300 0.87
301 0.87
302 0.88
303 0.83
304 0.82
305 0.82