Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q12404

Protein Details
Accession Q12404   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
292-318EYIAYLKTGKKPIKKNHSSSGNKHDELHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9E.R. 9, cyto 2, golg 2, vacu 2, nucl 1, plas 1, pero 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR044569  PDIA6-like  
IPR036249  Thioredoxin-like_sf  
IPR017937  Thioredoxin_CS  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005788  C:endoplasmic reticulum lumen  
GO:0000324  C:fungal-type vacuole  
GO:0003756  F:protein disulfide isomerase activity  
GO:0019153  F:protein-disulfide reductase (glutathione) activity  
GO:0015035  F:protein-disulfide reductase activity  
GO:0006457  P:protein folding  
GO:0034976  P:response to endoplasmic reticulum stress  
KEGG sce:YOR288C  -  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS00014  ER_TARGET  
PS00194  THIOREDOXIN_1  
PS51352  THIOREDOXIN_2  
CDD cd03002  PDI_a_MPD1_like  
Amino Acid Sequences MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVLFSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQRQSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTGKKPIKKNHSSSGNKHDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.09
6 0.1
7 0.12
8 0.14
9 0.14
10 0.14
11 0.16
12 0.2
13 0.22
14 0.25
15 0.25
16 0.25
17 0.23
18 0.22
19 0.27
20 0.27
21 0.28
22 0.28
23 0.27
24 0.28
25 0.3
26 0.33
27 0.35
28 0.38
29 0.41
30 0.44
31 0.47
32 0.44
33 0.43
34 0.44
35 0.37
36 0.3
37 0.23
38 0.17
39 0.15
40 0.15
41 0.14
42 0.18
43 0.17
44 0.17
45 0.22
46 0.23
47 0.27
48 0.3
49 0.34
50 0.32
51 0.43
52 0.52
53 0.55
54 0.61
55 0.65
56 0.71
57 0.74
58 0.72
59 0.69
60 0.66
61 0.62
62 0.56
63 0.52
64 0.47
65 0.4
66 0.37
67 0.3
68 0.22
69 0.18
70 0.16
71 0.11
72 0.07
73 0.06
74 0.1
75 0.11
76 0.13
77 0.17
78 0.17
79 0.2
80 0.26
81 0.27
82 0.24
83 0.29
84 0.3
85 0.28
86 0.33
87 0.31
88 0.28
89 0.28
90 0.26
91 0.2
92 0.17
93 0.16
94 0.11
95 0.14
96 0.13
97 0.13
98 0.16
99 0.16
100 0.2
101 0.23
102 0.25
103 0.28
104 0.34
105 0.39
106 0.38
107 0.44
108 0.46
109 0.44
110 0.43
111 0.39
112 0.35
113 0.31
114 0.32
115 0.29
116 0.27
117 0.27
118 0.29
119 0.27
120 0.23
121 0.23
122 0.2
123 0.16
124 0.12
125 0.11
126 0.07
127 0.06
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.06
135 0.08
136 0.13
137 0.13
138 0.13
139 0.13
140 0.15
141 0.19
142 0.24
143 0.31
144 0.29
145 0.37
146 0.38
147 0.4
148 0.44
149 0.39
150 0.36
151 0.28
152 0.28
153 0.21
154 0.21
155 0.19
156 0.15
157 0.18
158 0.18
159 0.17
160 0.17
161 0.18
162 0.21
163 0.21
164 0.23
165 0.25
166 0.27
167 0.29
168 0.29
169 0.3
170 0.27
171 0.27
172 0.25
173 0.24
174 0.24
175 0.23
176 0.25
177 0.22
178 0.24
179 0.23
180 0.22
181 0.21
182 0.19
183 0.2
184 0.16
185 0.18
186 0.16
187 0.15
188 0.15
189 0.12
190 0.11
191 0.1
192 0.18
193 0.17
194 0.24
195 0.29
196 0.3
197 0.35
198 0.39
199 0.38
200 0.37
201 0.44
202 0.43
203 0.48
204 0.49
205 0.47
206 0.44
207 0.44
208 0.39
209 0.31
210 0.26
211 0.17
212 0.2
213 0.19
214 0.22
215 0.24
216 0.24
217 0.3
218 0.33
219 0.34
220 0.3
221 0.35
222 0.37
223 0.43
224 0.46
225 0.44
226 0.47
227 0.52
228 0.56
229 0.55
230 0.52
231 0.46
232 0.45
233 0.42
234 0.37
235 0.34
236 0.3
237 0.33
238 0.36
239 0.34
240 0.31
241 0.32
242 0.32
243 0.27
244 0.27
245 0.25
246 0.2
247 0.27
248 0.32
249 0.32
250 0.33
251 0.34
252 0.34
253 0.3
254 0.31
255 0.23
256 0.25
257 0.25
258 0.26
259 0.31
260 0.33
261 0.33
262 0.32
263 0.36
264 0.33
265 0.35
266 0.34
267 0.31
268 0.31
269 0.3
270 0.34
271 0.29
272 0.28
273 0.25
274 0.29
275 0.3
276 0.27
277 0.29
278 0.29
279 0.34
280 0.39
281 0.39
282 0.37
283 0.41
284 0.45
285 0.48
286 0.53
287 0.55
288 0.57
289 0.63
290 0.7
291 0.75
292 0.81
293 0.81
294 0.83
295 0.86
296 0.86
297 0.84
298 0.84