Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6GEG3

Protein Details
Accession A0A0K6GEG3   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-107NPNKGKPREEKPKAKPKEKVNKEAAPKKKRAPKKAAPASSEBasic
NLS Segment(s)
PositionSequence
69-102NKGKPREEKPKAKPKEKVNKEAAPKKKRAPKKAA
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKAATTKTTKTAKEPKEPKEAKEKVPSPYQMFMKERLPTYKAEHPDVSHKDAFRSVALEWKDADANPNKGKPREEKPKAKPKEKVNKEAAPKKKRAPKKAAPASSEADDDKEAAEDDEEESN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.68
4 0.72
5 0.73
6 0.67
7 0.68
8 0.66
9 0.62
10 0.64
11 0.61
12 0.55
13 0.59
14 0.61
15 0.54
16 0.54
17 0.5
18 0.47
19 0.45
20 0.43
21 0.4
22 0.38
23 0.37
24 0.34
25 0.33
26 0.29
27 0.33
28 0.36
29 0.35
30 0.36
31 0.35
32 0.32
33 0.39
34 0.4
35 0.4
36 0.35
37 0.32
38 0.29
39 0.29
40 0.28
41 0.2
42 0.17
43 0.12
44 0.15
45 0.16
46 0.15
47 0.14
48 0.14
49 0.14
50 0.12
51 0.16
52 0.14
53 0.19
54 0.2
55 0.25
56 0.27
57 0.29
58 0.33
59 0.35
60 0.41
61 0.47
62 0.54
63 0.6
64 0.66
65 0.75
66 0.8
67 0.82
68 0.8
69 0.8
70 0.82
71 0.8
72 0.79
73 0.76
74 0.75
75 0.76
76 0.78
77 0.78
78 0.75
79 0.73
80 0.73
81 0.75
82 0.78
83 0.78
84 0.79
85 0.78
86 0.81
87 0.85
88 0.83
89 0.77
90 0.72
91 0.66
92 0.58
93 0.51
94 0.4
95 0.32
96 0.25
97 0.22
98 0.18
99 0.14
100 0.12
101 0.1
102 0.1
103 0.09