Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6FL06

Protein Details
Accession A0A0K6FL06    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGAKTLAKRKKIKPFIKSVNYTHHydrophilic
NLS Segment(s)
PositionSequence
9-11RKK
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR018262  Ribosomal_L27e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
PROSITE View protein in PROSITE  
PS01107  RIBOSOMAL_L27E  
Amino Acid Sequences MGAKTLAKRKKIKPFIKSVNYTHLFPTRYAVELENLKGTVQAETFKEPSQREDAKKNIKKMLEERYESGKNRWFFTPLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.84
4 0.81
5 0.73
6 0.72
7 0.66
8 0.58
9 0.51
10 0.46
11 0.38
12 0.32
13 0.32
14 0.23
15 0.22
16 0.22
17 0.19
18 0.16
19 0.17
20 0.17
21 0.15
22 0.14
23 0.12
24 0.12
25 0.11
26 0.09
27 0.08
28 0.09
29 0.09
30 0.11
31 0.13
32 0.14
33 0.18
34 0.18
35 0.2
36 0.26
37 0.31
38 0.32
39 0.37
40 0.44
41 0.51
42 0.57
43 0.6
44 0.59
45 0.56
46 0.58
47 0.57
48 0.59
49 0.56
50 0.54
51 0.52
52 0.53
53 0.57
54 0.54
55 0.53
56 0.51
57 0.45
58 0.44
59 0.44
60 0.4