Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q02204

Protein Details
Accession Q02204   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
38-57DFMSWFKRKKQEEHQEPVKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
IPR018305  Ribosomal_L50_mt  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YKR006C  -  
Pfam View protein in Pfam  
PF10501  Ribosomal_L50  
Amino Acid Sequences MSSLLKLHCIRPLPQRSVWLSGYKQKARCIHSSAANGDFMSWFKRKKQEEHQEPVKDTKQLIKDIEEGTNEASSQSSSNNKNRLELIPENFIGEGSRRCKRQKELKLAVSSAPFNQWLSRDKITSDNQLDDMILQATEKTLGKVDQDVQFSDLVAKFQFTKFLQSKSGYLIPDYELTTLSTPLQFKRYIKEKILPSANDPKLAYKEAEPNAIHPFSDNYASPNIYVVNDVTSKEQKSKYDTIMKEIQKLEDDATRKALETARSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.55
4 0.58
5 0.55
6 0.51
7 0.47
8 0.49
9 0.55
10 0.55
11 0.55
12 0.56
13 0.61
14 0.6
15 0.62
16 0.59
17 0.55
18 0.55
19 0.57
20 0.53
21 0.47
22 0.43
23 0.37
24 0.31
25 0.26
26 0.2
27 0.19
28 0.2
29 0.21
30 0.26
31 0.35
32 0.41
33 0.49
34 0.59
35 0.65
36 0.7
37 0.77
38 0.8
39 0.78
40 0.75
41 0.73
42 0.65
43 0.56
44 0.48
45 0.45
46 0.4
47 0.38
48 0.37
49 0.33
50 0.34
51 0.33
52 0.34
53 0.28
54 0.24
55 0.21
56 0.19
57 0.16
58 0.12
59 0.1
60 0.08
61 0.08
62 0.1
63 0.15
64 0.21
65 0.28
66 0.35
67 0.35
68 0.37
69 0.39
70 0.38
71 0.38
72 0.37
73 0.33
74 0.3
75 0.3
76 0.28
77 0.25
78 0.23
79 0.17
80 0.14
81 0.16
82 0.16
83 0.21
84 0.25
85 0.29
86 0.35
87 0.44
88 0.53
89 0.58
90 0.64
91 0.68
92 0.7
93 0.69
94 0.64
95 0.58
96 0.49
97 0.4
98 0.29
99 0.22
100 0.15
101 0.13
102 0.12
103 0.13
104 0.14
105 0.18
106 0.19
107 0.18
108 0.19
109 0.24
110 0.26
111 0.3
112 0.28
113 0.24
114 0.23
115 0.23
116 0.21
117 0.15
118 0.13
119 0.07
120 0.05
121 0.04
122 0.04
123 0.03
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.09
131 0.12
132 0.15
133 0.16
134 0.16
135 0.16
136 0.16
137 0.15
138 0.16
139 0.13
140 0.09
141 0.08
142 0.09
143 0.09
144 0.09
145 0.14
146 0.12
147 0.2
148 0.22
149 0.24
150 0.28
151 0.28
152 0.29
153 0.28
154 0.32
155 0.24
156 0.22
157 0.2
158 0.17
159 0.17
160 0.17
161 0.14
162 0.1
163 0.11
164 0.11
165 0.11
166 0.11
167 0.11
168 0.12
169 0.13
170 0.16
171 0.19
172 0.2
173 0.27
174 0.34
175 0.37
176 0.4
177 0.46
178 0.47
179 0.51
180 0.56
181 0.5
182 0.48
183 0.52
184 0.49
185 0.46
186 0.42
187 0.38
188 0.35
189 0.35
190 0.31
191 0.24
192 0.31
193 0.28
194 0.35
195 0.31
196 0.3
197 0.34
198 0.33
199 0.3
200 0.23
201 0.23
202 0.18
203 0.21
204 0.19
205 0.15
206 0.18
207 0.19
208 0.18
209 0.17
210 0.16
211 0.13
212 0.14
213 0.12
214 0.12
215 0.13
216 0.14
217 0.18
218 0.22
219 0.24
220 0.29
221 0.33
222 0.34
223 0.41
224 0.45
225 0.48
226 0.53
227 0.52
228 0.52
229 0.57
230 0.56
231 0.55
232 0.52
233 0.47
234 0.4
235 0.4
236 0.35
237 0.33
238 0.33
239 0.28
240 0.31
241 0.29
242 0.27
243 0.29
244 0.3