Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6GEA7

Protein Details
Accession A0A0K6GEA7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
8-35ATSSGGKAAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
11-29SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPKAKAAATSSGGKAAKKKKWSKGKVKDKAQHAVTLNQATYDRIIKEVPTFKFISQSILIERLKIGGSLARVAIKHLANEGQIKKIVHHNGQLIYTRATASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.45
4 0.51
5 0.6
6 0.63
7 0.73
8 0.81
9 0.84
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.82
17 0.72
18 0.67
19 0.58
20 0.51
21 0.44
22 0.38
23 0.32
24 0.24
25 0.23
26 0.17
27 0.16
28 0.15
29 0.12
30 0.11
31 0.11
32 0.1
33 0.14
34 0.2
35 0.19
36 0.21
37 0.22
38 0.21
39 0.24
40 0.23
41 0.23
42 0.17
43 0.18
44 0.15
45 0.19
46 0.19
47 0.16
48 0.16
49 0.13
50 0.12
51 0.12
52 0.11
53 0.07
54 0.08
55 0.09
56 0.1
57 0.1
58 0.1
59 0.12
60 0.16
61 0.15
62 0.15
63 0.15
64 0.16
65 0.16
66 0.24
67 0.24
68 0.23
69 0.26
70 0.26
71 0.26
72 0.33
73 0.38
74 0.35
75 0.39
76 0.4
77 0.39
78 0.42
79 0.43
80 0.37
81 0.33
82 0.29