Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P35203

Protein Details
Accession P35203    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-71DVELPGKPSYKRSKRSKKLLRYMYPVFAHydrophilic
NLS Segment(s)
PositionSequence
54-61KRSKRSKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Gene Ontology GO:0031518  C:CBF3 complex  
GO:0000776  C:kinetochore  
GO:0008301  F:DNA binding, bending  
GO:0051382  P:kinetochore assembly  
GO:0000921  P:septin ring assembly  
KEGG sce:YMR094W  -  
CDD cd19611  Ctf13_LRR_LRR-insertion  
Amino Acid Sequences MPSFNPVRFLELPIDIRKEVYFHLDGNFCGAHPYPIDILYKSNDVELPGKPSYKRSKRSKKLLRYMYPVFATYLNIFEYSPQLIEKWLEYAFWLRYDCLVLDCFKVNHLYDGTLIDALEWTYLDNELRLAYFNKASMLEVWYTFKEYKKWVIDSVAFDELDLLNVSNIQFNIDNLTPQLVDKCLSILEQKDLFATIGEVQFGQDEEVGEEKDVDVSGANSDENSSPSSTIKNKKRSASKRSHSDNGNVGATHNQLTSISVIRTIRSMESMKSLRKITVRGEKLYELLINFHGFRDNPGKTISYIVKRRINEIRLSRMNQISRTGLADFTRWDNLQKLVLSRVAYIDLNSIVFPKNFKSLTMKRVSKIKWWNIEENILKELKVDKRTFKSLYIKEDDSKFTKFFNLRHTRIKELDKSEINQITYLRCQAIVWLSFRTLNHIKLQNVSEVFNNIIVPRALFDSKRVEIYRCEKISQVLVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.33
3 0.34
4 0.31
5 0.29
6 0.25
7 0.27
8 0.24
9 0.21
10 0.26
11 0.26
12 0.25
13 0.27
14 0.26
15 0.19
16 0.2
17 0.19
18 0.17
19 0.16
20 0.19
21 0.16
22 0.18
23 0.21
24 0.18
25 0.21
26 0.22
27 0.24
28 0.21
29 0.22
30 0.2
31 0.2
32 0.23
33 0.22
34 0.25
35 0.26
36 0.3
37 0.29
38 0.37
39 0.46
40 0.52
41 0.61
42 0.66
43 0.74
44 0.8
45 0.9
46 0.92
47 0.92
48 0.93
49 0.93
50 0.9
51 0.87
52 0.81
53 0.76
54 0.67
55 0.57
56 0.48
57 0.37
58 0.32
59 0.25
60 0.21
61 0.16
62 0.15
63 0.14
64 0.13
65 0.14
66 0.13
67 0.13
68 0.11
69 0.11
70 0.12
71 0.13
72 0.13
73 0.13
74 0.12
75 0.11
76 0.12
77 0.16
78 0.16
79 0.17
80 0.18
81 0.16
82 0.17
83 0.18
84 0.17
85 0.14
86 0.15
87 0.14
88 0.15
89 0.17
90 0.16
91 0.16
92 0.19
93 0.18
94 0.19
95 0.19
96 0.17
97 0.16
98 0.16
99 0.16
100 0.13
101 0.12
102 0.09
103 0.08
104 0.07
105 0.07
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.08
116 0.09
117 0.11
118 0.12
119 0.12
120 0.13
121 0.13
122 0.14
123 0.13
124 0.14
125 0.13
126 0.13
127 0.15
128 0.14
129 0.17
130 0.18
131 0.19
132 0.2
133 0.22
134 0.29
135 0.32
136 0.33
137 0.32
138 0.34
139 0.35
140 0.34
141 0.35
142 0.3
143 0.24
144 0.22
145 0.21
146 0.17
147 0.14
148 0.11
149 0.08
150 0.05
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.08
157 0.08
158 0.12
159 0.11
160 0.11
161 0.1
162 0.11
163 0.09
164 0.09
165 0.1
166 0.07
167 0.08
168 0.08
169 0.08
170 0.07
171 0.08
172 0.1
173 0.1
174 0.13
175 0.13
176 0.13
177 0.13
178 0.13
179 0.13
180 0.1
181 0.1
182 0.08
183 0.07
184 0.08
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.04
207 0.06
208 0.06
209 0.07
210 0.08
211 0.08
212 0.08
213 0.09
214 0.12
215 0.18
216 0.27
217 0.34
218 0.42
219 0.47
220 0.53
221 0.63
222 0.68
223 0.72
224 0.73
225 0.72
226 0.72
227 0.73
228 0.73
229 0.65
230 0.59
231 0.54
232 0.46
233 0.39
234 0.29
235 0.23
236 0.19
237 0.17
238 0.14
239 0.1
240 0.08
241 0.07
242 0.08
243 0.08
244 0.08
245 0.08
246 0.1
247 0.1
248 0.1
249 0.11
250 0.11
251 0.1
252 0.12
253 0.13
254 0.11
255 0.17
256 0.2
257 0.22
258 0.24
259 0.25
260 0.25
261 0.26
262 0.28
263 0.28
264 0.35
265 0.36
266 0.34
267 0.36
268 0.34
269 0.32
270 0.3
271 0.25
272 0.15
273 0.13
274 0.13
275 0.11
276 0.11
277 0.1
278 0.11
279 0.1
280 0.13
281 0.19
282 0.18
283 0.18
284 0.2
285 0.2
286 0.19
287 0.23
288 0.25
289 0.26
290 0.32
291 0.38
292 0.42
293 0.42
294 0.47
295 0.5
296 0.49
297 0.48
298 0.48
299 0.49
300 0.49
301 0.51
302 0.51
303 0.49
304 0.48
305 0.42
306 0.4
307 0.32
308 0.28
309 0.26
310 0.22
311 0.18
312 0.16
313 0.15
314 0.14
315 0.15
316 0.17
317 0.15
318 0.16
319 0.17
320 0.18
321 0.2
322 0.19
323 0.18
324 0.18
325 0.21
326 0.2
327 0.18
328 0.17
329 0.16
330 0.15
331 0.14
332 0.13
333 0.11
334 0.1
335 0.1
336 0.11
337 0.1
338 0.11
339 0.12
340 0.12
341 0.17
342 0.17
343 0.19
344 0.27
345 0.31
346 0.4
347 0.48
348 0.5
349 0.48
350 0.56
351 0.57
352 0.57
353 0.61
354 0.61
355 0.6
356 0.62
357 0.65
358 0.59
359 0.65
360 0.59
361 0.51
362 0.46
363 0.37
364 0.32
365 0.26
366 0.3
367 0.29
368 0.34
369 0.36
370 0.4
371 0.46
372 0.53
373 0.53
374 0.55
375 0.58
376 0.55
377 0.59
378 0.57
379 0.55
380 0.53
381 0.55
382 0.53
383 0.46
384 0.45
385 0.37
386 0.32
387 0.36
388 0.36
389 0.36
390 0.42
391 0.48
392 0.49
393 0.59
394 0.62
395 0.61
396 0.63
397 0.68
398 0.65
399 0.6
400 0.63
401 0.58
402 0.55
403 0.57
404 0.55
405 0.48
406 0.42
407 0.38
408 0.33
409 0.32
410 0.32
411 0.25
412 0.21
413 0.2
414 0.21
415 0.25
416 0.25
417 0.24
418 0.23
419 0.24
420 0.27
421 0.27
422 0.32
423 0.31
424 0.3
425 0.36
426 0.41
427 0.41
428 0.43
429 0.45
430 0.44
431 0.41
432 0.39
433 0.33
434 0.29
435 0.28
436 0.23
437 0.22
438 0.15
439 0.17
440 0.16
441 0.14
442 0.13
443 0.17
444 0.19
445 0.19
446 0.23
447 0.28
448 0.3
449 0.37
450 0.38
451 0.36
452 0.41
453 0.47
454 0.53
455 0.49
456 0.48
457 0.43
458 0.44