Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G529

Protein Details
Accession A0A0K6G529   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
145-169VTWAIAEKKARDRRRSRRNGGGGGGHydrophilic
NLS Segment(s)
PositionSequence
152-169KKARDRRRSRRNGGGGGG
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MTTYTLSRTSPKNTVLTDPEGKEAYQISSKYHLGGSETTVKRGDQVLATIHWKWFLRSTITWDGQTTKIDEIFPRSRRLSVSRIYTTPSGEKFKWKDKARLYCVSVDTGLNLATYERVHFRYFRDKKSTLDITSAGAHVADALVVTWAIAEKKARDRRRSRRNGGGGGGGGGDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.47
4 0.47
5 0.43
6 0.41
7 0.37
8 0.35
9 0.3
10 0.27
11 0.23
12 0.21
13 0.21
14 0.2
15 0.24
16 0.24
17 0.24
18 0.24
19 0.21
20 0.19
21 0.19
22 0.2
23 0.25
24 0.25
25 0.26
26 0.26
27 0.25
28 0.25
29 0.25
30 0.23
31 0.13
32 0.14
33 0.14
34 0.15
35 0.18
36 0.18
37 0.17
38 0.18
39 0.18
40 0.18
41 0.19
42 0.2
43 0.21
44 0.21
45 0.28
46 0.32
47 0.34
48 0.33
49 0.3
50 0.31
51 0.28
52 0.28
53 0.22
54 0.15
55 0.14
56 0.14
57 0.14
58 0.18
59 0.24
60 0.25
61 0.29
62 0.29
63 0.29
64 0.31
65 0.34
66 0.32
67 0.29
68 0.34
69 0.31
70 0.3
71 0.32
72 0.3
73 0.28
74 0.26
75 0.24
76 0.22
77 0.2
78 0.26
79 0.27
80 0.34
81 0.42
82 0.44
83 0.49
84 0.53
85 0.62
86 0.61
87 0.64
88 0.58
89 0.53
90 0.49
91 0.43
92 0.35
93 0.26
94 0.2
95 0.14
96 0.12
97 0.08
98 0.07
99 0.05
100 0.05
101 0.06
102 0.07
103 0.09
104 0.11
105 0.13
106 0.15
107 0.19
108 0.29
109 0.35
110 0.41
111 0.47
112 0.47
113 0.47
114 0.54
115 0.56
116 0.46
117 0.43
118 0.36
119 0.3
120 0.29
121 0.27
122 0.19
123 0.13
124 0.11
125 0.08
126 0.07
127 0.05
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.05
135 0.05
136 0.07
137 0.1
138 0.14
139 0.25
140 0.35
141 0.45
142 0.54
143 0.65
144 0.74
145 0.83
146 0.9
147 0.88
148 0.89
149 0.88
150 0.84
151 0.76
152 0.7
153 0.59
154 0.48
155 0.39