Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6GDB3

Protein Details
Accession A0A0K6GDB3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MYIQTKKRRNGGRNKHGRGHTSBasic
NLS Segment(s)
PositionSequence
6-17KKRRNGGRNKHG
90-111RSREGRRNRAPPPRIRFKDGKK
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MYIQTKKRRNGGRNKHGRGHTSFVRCSNCSRCVPKDKAIKRFTVRNMVESAAVRDISEASVYTEYAIPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRIRFKDGKKVNPAVATAEGDKPAAGAAGAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.82
4 0.78
5 0.72
6 0.68
7 0.65
8 0.61
9 0.57
10 0.54
11 0.54
12 0.49
13 0.5
14 0.49
15 0.47
16 0.47
17 0.5
18 0.51
19 0.54
20 0.58
21 0.61
22 0.65
23 0.66
24 0.7
25 0.67
26 0.67
27 0.63
28 0.65
29 0.61
30 0.61
31 0.54
32 0.46
33 0.44
34 0.37
35 0.34
36 0.27
37 0.24
38 0.15
39 0.14
40 0.12
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.12
61 0.13
62 0.14
63 0.14
64 0.14
65 0.13
66 0.12
67 0.13
68 0.13
69 0.18
70 0.17
71 0.2
72 0.23
73 0.27
74 0.28
75 0.3
76 0.33
77 0.36
78 0.42
79 0.47
80 0.54
81 0.59
82 0.66
83 0.71
84 0.74
85 0.76
86 0.78
87 0.79
88 0.79
89 0.8
90 0.76
91 0.75
92 0.76
93 0.74
94 0.76
95 0.76
96 0.76
97 0.73
98 0.73
99 0.7
100 0.63
101 0.56
102 0.49
103 0.42
104 0.36
105 0.29
106 0.26
107 0.23
108 0.2
109 0.19
110 0.15
111 0.13
112 0.1