Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q03246

Protein Details
Accession Q03246    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
210-229EDPLTLKKNIKKNLLRKHVMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG sce:YMR188C  -  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MARQNFLGLVVSQGKMQKTVKVRVETKVFNKKINKELFHRRDYLVHDEGEISREGDLVRIEATRPLSKRKFFAIAEIIRNKGQQFALYESEAQLSVAKEEAQKAKEFLDKRSVRENKLNEKTTLLRDIRTIQDALSSGSTPKELLEIKQRYGIQDFSQETVRQLLQLDISGLEVNLEKQRSLIDRIQTRLSELLSNDLKCDQFLKDHGVEDPLTLKKNIKKNLLRKHVMMDMQQPSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.27
4 0.29
5 0.33
6 0.42
7 0.47
8 0.52
9 0.55
10 0.56
11 0.62
12 0.63
13 0.65
14 0.67
15 0.62
16 0.62
17 0.67
18 0.66
19 0.68
20 0.7
21 0.66
22 0.63
23 0.71
24 0.71
25 0.68
26 0.65
27 0.58
28 0.54
29 0.53
30 0.53
31 0.44
32 0.36
33 0.31
34 0.29
35 0.28
36 0.25
37 0.2
38 0.13
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.11
49 0.15
50 0.19
51 0.21
52 0.3
53 0.36
54 0.39
55 0.41
56 0.42
57 0.44
58 0.39
59 0.42
60 0.41
61 0.39
62 0.43
63 0.43
64 0.41
65 0.35
66 0.36
67 0.31
68 0.26
69 0.21
70 0.16
71 0.16
72 0.18
73 0.19
74 0.19
75 0.19
76 0.16
77 0.16
78 0.14
79 0.12
80 0.1
81 0.08
82 0.07
83 0.07
84 0.08
85 0.08
86 0.11
87 0.15
88 0.15
89 0.15
90 0.16
91 0.17
92 0.22
93 0.22
94 0.22
95 0.28
96 0.29
97 0.31
98 0.4
99 0.42
100 0.41
101 0.46
102 0.5
103 0.49
104 0.55
105 0.55
106 0.45
107 0.44
108 0.42
109 0.37
110 0.39
111 0.3
112 0.23
113 0.22
114 0.24
115 0.22
116 0.22
117 0.2
118 0.12
119 0.13
120 0.13
121 0.12
122 0.11
123 0.09
124 0.08
125 0.08
126 0.08
127 0.07
128 0.07
129 0.09
130 0.09
131 0.1
132 0.2
133 0.22
134 0.23
135 0.28
136 0.29
137 0.28
138 0.29
139 0.29
140 0.2
141 0.24
142 0.24
143 0.2
144 0.23
145 0.21
146 0.2
147 0.21
148 0.2
149 0.14
150 0.13
151 0.13
152 0.1
153 0.1
154 0.1
155 0.07
156 0.08
157 0.07
158 0.06
159 0.06
160 0.06
161 0.08
162 0.11
163 0.11
164 0.11
165 0.11
166 0.14
167 0.16
168 0.21
169 0.24
170 0.28
171 0.33
172 0.36
173 0.4
174 0.38
175 0.37
176 0.33
177 0.3
178 0.25
179 0.21
180 0.25
181 0.25
182 0.25
183 0.24
184 0.25
185 0.24
186 0.21
187 0.23
188 0.17
189 0.16
190 0.19
191 0.24
192 0.23
193 0.25
194 0.25
195 0.26
196 0.25
197 0.22
198 0.24
199 0.21
200 0.22
201 0.22
202 0.28
203 0.32
204 0.41
205 0.48
206 0.53
207 0.6
208 0.67
209 0.77
210 0.81
211 0.79
212 0.73
213 0.71
214 0.68
215 0.62
216 0.56
217 0.53